FASTA-Format

aus Wikipedia, der freien Enzyklopädie
Wechseln zu: Navigation, Suche

Das FASTA-Format ist ein textbasiertes Format zur Darstellung und Speicherung der Primärstruktur von Nukleinsäuren (Nukleinsäuresequenz) und Proteinen (Proteinsequenz) in der Bioinformatik. Die Nukleinbasen bzw. Aminosäuren werden durch einen Ein-Buchstaben-Code dargestellt. Das Format erlaubt es, den Sequenzen einen Namen und Kommentare voranzustellen.

Die Einfachheit des Formates macht es Textverarbeitungswerkzeugen und Skriptsprachen leicht, die Daten einzulesen und zu verarbeiten.

Format[Bearbeiten]

Eine Sequenz im FASTA-Format beginnt mit einer einzeiligen Beschreibung, dann folgen die Sequenzdaten. Es wird empfohlen, dass jede Zeile der Datei maximal 80 Zeichen enthalten soll. Eine Sequenz endet mit dem auftauchen einer weiteren Kopfzeile.

Es folgt ein einfaches Beispiel einer Proteinsequenz im FASTA-Format vom Cytochrom b des Asiatischen Elefanten: (siehe auch [1])

>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
IENY

Kopfzeile[Bearbeiten]

Die Kopfzeile (engl. Headerline) ist die Zeile, die einen (eindeutigen) Namen sowie eine Beschreibung der jeweiligen Sequenz beinhaltet. Sie steht den Sequenzdaten voran und beginnt mit einem Größer-Als-Zeichen (">"). Ohne Leerzeichen folgt daraufhin der Name und/oder eine ID der Sequenz. Viele Sequenzdatenbanken benutzen standardisierte Kopfzeilen, welche es erlauben, automatisch verschiedene Informationen aus der Kopfzeile zu beziehen. Die Kopfzeile kann auch mehrere IDs enthalten, welche dann durch ein ^A (Control-A) Zeichen separiert werden. (Siehe [2]) Die Kopfzeile in dieser Form ist optional. Wichtig ist, dass mehrere Sequenzen in einer FASTA-Datei durch ein "> + Beschreibung" voneinander getrennt werden.

Kommentare[Bearbeiten]

Nach der Kopfzeile folgen optional eine oder mehrere Kommentarzeilen, welche jeweils mit einem Semikolon (";") beginnen. Auch das Semikolon muss das erste Zeichen in der jeweiligen Zeile sein. Viele Datenbanken und Anwendungsprogramme erkennen die Kommentare nicht, daher finden sich diese Kommentare praktisch in keiner aktuellen Sequenzdatenbank. Sie sind jedoch Teil des offiziellen Formates. Ein Beispiel einer FASTA-Datei mit mehreren Sequenzen, sowie Kommentarzeilen:

>Sequenz 1
;Kommentarzeile A
MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG
LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK
IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL
MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGEVAAQL
>Sequenz 2
;Kommentarzeile B
;Kommentarzeile C
SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI
ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH

Sequenzdarstellung[Bearbeiten]

Nach Kopfzeile und Kommentar folgen eine oder mehrere Zeilen, die die Sequenz enthalten. Jede Zeile sollte nicht mehr als 80 Zeichen beinhalten. Sequenzen können Protein- oder Nukleinsäuresequenzen sein, dürfen Lücken und Alinierungszeichen enthalten. Die Sequenzen sollten gemäß den IUB/IUPAC-Standardcodes für Aminosäuren und Nukleinsäuren angegeben werden. Erlaubte Ausnahmen sind hierbei:

  • Kleinbuchstaben sind zulässig, werden aber in Großbuchstaben umgewandelt
  • Ein Binde- oder Gedankenstrich stellt eine Lücke dar
  • In Aminosäuresequenzen stellen "U" und "*" zulässige Zeichen dar. (Siehe unten)
  • Nukleotidsequenzen werden in 5' nach 3' Richtung dargestellt.

Numerische Zeichen sind nicht erlaubt, werden jedoch in einigen Datenbanken verwendet um die Position der Sequenz anzuzeigen.

Erlaubte Codes für Nukleinbasen
Code Bedeutung
A Adenin
C Cytosin
G Guanin
T Thymin
U Uracil
R G A (PuRine)
Y T C (PYrimidine)
K G T (Ketone)
M A C (AMinogruppen)
S G C (Starke Wechselwirkung)
W A T (Weiche Wechselwirkung)
B G T C (nicht A) (B kommt nach A)
D G A T (nicht C) (D kommt nach C)
H A C T (nicht G) (H kommt nach G)
V G C A (nicht T, nicht U) (V kommt nach U)
N A G C T (aNy)
- Lücke unbestimmter Länge
Tabelle II: Erlaubte Codes für Aminosäuren
Code Bedeutung
A Alanin
B Asparaginsäure or Asparagin
C Cystein
D Aspartat
E Glutamat
F Phenylalanin
G Glycin
H Histidin
I Isoleucin
K Lysin
L Leucin
M Methionin
N Asparagin
P Prolin
Q Glutamin
R Arginin
S Serin
T Threonin
U Selenocystein
V Valin
W Tryptophan
Y Tyrosin
Z Glutamat oder Glutamin
X jede Aminosäure
* Stop der Translation
- Lücke unbestimmter Länge

Dateierweiterung[Bearbeiten]

Es gibt keine Standard-Dateierweiterung für eine Textdatei im FASTA-Format. Jedoch werden folgende Erweiterungen häufig verwendet: .fa, .mpfa, .fna, .fsa oder .fasta.

Sequenz-IDs[Bearbeiten]

Das National Center for Biotechnology Information hat einen Standard für eine ID definiert, die für Sequenzen verwendet werden. Diese "SeqID" wird in der Kopfzeile verwendet. Die Hilfeseite der formatdb gibt folgendes an: "formatdb will automatically parse the SeqID and create indexes, but the database identifiers in the FASTA definition line must follow the conventions of the FASTA Defline Format."

Dies ist jedoch keine endgültige Definition für das Kopfzeilen-Format. Verschiedene Möglichkeiten sind nachfolgend dargestellt:

GenBank gi|gi-number|gb|accession|locus
EMBL Data Library gi|gi-number|emb|accession|locus
DDBJ, DNA Database of Japan gi|gi-number|dbj|accession|locus
NBRF PIR pir||entry
Protein Research Foundation prf||name
SWISS-PROT sp|accession|name
TrEMBL tr|accession|name
Brookhaven Protein Data Bank (1) pdb|entry|chain
Brookhaven Protein Data Bank (2) entry:chain|PDBID|CHAIN|SEQUENCE
Patents pat|country|number
GenInfo Backbone Id bbs|number
General database identifier gnl|database|identifier
NCBI Reference Sequence ref|accession|locus
Local Sequence identifier lcl|identifier

Die vertikalen Striche sind keine Separatoren gemäß der Backus-Naur Form, sondern Teil des Formats.

Siehe auch[Bearbeiten]

Weblinks[Bearbeiten]