Wikipedia:Redaktion Chemie

aus Wikipedia, der freien Enzyklopädie
Wechseln zu: Navigation, Suche
Autorenportal > Redaktionen > Redaktion Chemie

Redaktionen in der Wikipedia

Antike · Bilder · Biologie · Chemie · Film und Fernsehen · Geisteswissenschaften · Geschichte · Informatik · Luftbilder · Medizin · Musik · Naturwissenschaft und Technik · Nordische Länder · Ostasien · Physik · Recht · Religion · Sexualität
Weitere Redaktionen · WikiProjekte · Portale

Themenbereich Chemie: Redaktion | PortalAbkürzung: WP:RC
WikiRedakChemNeu.png

Neuer Beitrag

Redaktion Chemie

Dies ist die Redaktion Chemie. Diese Seite ist Anlaufstelle für Diskussionen und Artikelarbeit im Bereich der Chemie.

Alle Diskussionen die drei Tage lang mit dem Baustein „{{Erledigt|~~~~}}“ markiert sind, werden automatisch in unser Archiv verschoben.

Von der Artikeldiskussionsseite kann mit Hilfe der Vorlage {{War in Redaktion Chemie}} auf die im Redaktionsarchiv befindliche Diskussion verlinkt werden.

Diskussionen die 60 Tage alt, aber noch nicht erledigt sind, werden zu unseren Knacknüssen verschoben. Bitte sieh also dort (immer wieder einmal) nach, ob Du etwas zu unseren Knacknüssen beitragen kannst, damit sie irgendwann geknackt werden!

Auszeichnungskandidatur

(zur Zeit keine) bearbeiten

Kandidat Bildauszeichnung

Datei:Kawah-Ijen Indonesia Ijen-Sulfur-Miner-01.jpg (FPC+) · Datei:Multi plate pipe installation.jpg (FPC+) · Datei:Safran-Weinviertel Niederreiter 2 Gramm 8285.jpg (KEB) · Datei:Titanium crystal-bars.jpg (FPC+)

Review

(zur Zeit keine)

Neu angelegte oder wesentlich überarbeitete Artikel im Bereich Chemie

01.03. 4,4'-OxydianilinKaliumhydrogensulfid – 28.02. Guajazulen – 27.02. TolprocarbPicarbutrazox – 26.02. StrontiumaluminatFlufenoxystrobinPyrametostrobin – 25.02. Tetraisopropylorthotitanat – 22.02. Endosporenfärbung – 21.01. Fenamistrobin – 20.02. Pyrisoxazol – 19.02. MethoprenAlpha-GPCLysophosphatidylinositol – 17.02. Ledol8-Anilinonaphthalin-1-sulfonsäure – 16.02. Thermal Shift Assay – 13.02. CoumoxystrobinEnoxastrobin – 12.02. Grenzwert (Chemie)FurametpyrThifluzamidIsofetamidTeduglutid – 11.02. Ipsdienol – 10.02. Liste der Emissionslinien von LithiumFowler-ProzessFluorinert

Fehlende Artikel und Artikelwünsche im Bereich Chemie

Atmosphärische DestillationCuprenGermanene (en)HypoioditeMolekulare Mechanik (en)Intraflagellarer Transport (en)Ionensensitive Elektrode (en)Journal of the Less Common MetalsKupferron (en)PhotopolymerisationPhotosystem I (en)SchichtstrukturThioflavinVincentitmehr

Löschkandidat

Liste der Emissionslinien von Helium (LA-13.2.) · Liste der Emissionslinien von Lithium (LA-13.2.) · Liste der Emissionslinien von Wasserstoff (LA-10.2.) · -mer (LA-28.2.) · Datei:Kugelhaufenreaktor, Brennelemente im coated Particles.jpg (CDR)
Weitere Löschanträge auf Commons

Spam-Blacklist

lmgtfy.com · toxcenter.de

Qualitätssicherung

Deliqueszenz (QS-24.1.) · Max Fischer (Kunstsammler) (QS-10.2.) · Fluoreszenzlebensdauer-Mikroskopie (Physik) · Hydroxychloroquin (Medizin) · Konvektion (Wärmeübertragung) (Physik) · Liste der Emissionslinien von Wasserstoff (Physik) · Normalschwingungen (Physik) · Polymerphysik (Physik) · Psychopharmakon (Medizin) · Spaltbruchspannung (QS-20.1.) · Spezifische Ausstrahlung (Physik) · Thermodynamischer Kreisprozess (Physik) · Tonizität (BKS) · Vergleichsprozess (Physik)

Eintragung fehlt

Cashmeran ([[Wikipedia:Redaktion Chemie/Qualitätssicherung]]) · Hydroxyethylcellulose ([[Wikipedia:Redaktion Chemie/Qualitätssicherung]]) · Konvektion (Wärmeübertragung) ([[Wikipedia:Redaktion Physik/Qualitätssicherung]])

└─── Hinweis: Klick auf Bild führt zu entsprechenden Erläuterungen
Ankündigung Ankündigungen:

• Jahrestreffen 2015: Planungsseite

Aktuelles aus der Chemie in den Medien In den Medien:
  • 12. Februar 2015: Salpetersäure und Eisen(III)-chlorid - Orange Wolke zieht nach Explosion in Lagerhaus über die spanische Stadt Igualada
  • 9. Januar 2015: Alkylamin - Fünf Personen in Lübeck bei Kontakt verletzt
  • 23. Dezember 2014: Salpetersäure - Großeinsatz der Feuerwehr bei einem Unfall in einer Brauerei in Teisendorf
  • 20. Dezember 2014: Aluminiumphosphid - A7 gesperrt wegen LKW-Unfall
  • 18. Dezember 2014: Tropanalkaloide - Alnatura ruft Getreidebrei für Säuglinge zurück
  • 1. Dezember 2014: Flammschutzmittel - Bei einer Explosion in einer Fabrik in Pirna kommt ein Mann ums Leben.

Knacknüsse (Reiten toter Pferde)[Bearbeiten]

Ich habe einige Knacknüsse auf erledigt gesetzt, weil m.E. keine Lösung in Sicht ist (und wohl auch keiner mehr Lust dazu hat). Ich schlage vor, Knacknüsse, die beim letzten signifikanten Eintrag mehr als ein Jahr haben, als erledigt zu setzen und zu archivieren. Viele Grüße --JWBE (Diskussion) 08:14, 26. Nov. 2014 (CET). Bezieht sich ein Eintrag konkret auf einen Artikel, so sollte das besser auf die zugehörige Artikeldiskussion geschoben werden. --JWBE (Diskussion) 08:18, 26. Nov. 2014 (CET)

So pauschal bin ich nicht einverstanden. Bei einigen Abschnitten fehlt nicht viel, um die Knacknuss zu lösen. Da wäre zuerst ein Anpingen der betreffenden Benutzer sinnvoll, da wohl der Abschnitt einfach in Vergessenheit geriet. --Leyo 16:39, 26. Nov. 2014 (CET) PS. Ggf. macht es Sinn, die Vorlage:War in Redaktion Chemie auf die Artikeldisk. zu setzen.
@JWBE: wie könnte man vermeiden, dass die zu erledigenden Punkte auf der Diskussionsseite vor sich hin "reifen"? Was hältst Du vom Ping der QS-Diskussionsteilnehmer? Grüße, --Ghilt (Diskussion) 18:19, 16. Dez. 2014 (CET)
Man könnte ja mal im Rahmen eines Wartungsbausteinwettbewerbs die Knacknüsse wieder aufwärmen. Rjh (Diskussion) 09:21, 13. Feb. 2015 (CET)

Fehlende CAS-Nummern[Bearbeiten]

Bei folgenden Artikeln ist keine CAS-Nummer angegeben:

Kann es sein, dass sie tatsächlich keine CAS-Nummer haben? Dann sollte dies mittels „keine CAS-Nummer vergeben“ oder ähnlich in die Chemobox eingetragen werden. Ich habe leider keinen Zugriff auf den SciFinder, um dort zu suchen. --Leyo 10:48, 2. Dez. 2014 (CET)

Bis auf Glucopyranosyloxymethyluracil, Agmatidin und Salinosporamid hab ich bei allen längere Zeit gesucht und keine CAS gefunden. Ich kann natürlich nicht ausschliessen, dass es dennoch eine gibt. Rjh (Diskussion) 17:01, 2. Dez. 2014 (CET)
Hast du auch mittels SciFinder gesucht? IMHO ist dies notwendig, um für „keine CAS-Nummer vergeben“ sicher zu sein. --Leyo 19:40, 2. Dez. 2014 (CET)
Teilweise. Rjh (Diskussion) 08:24, 20. Dez. 2014 (CET)
Bei drei Artikeln, die auch in der en-WP existieren, haben die dortigen Kollegen geholfen, so dass noch 13 Fälle offen sind. --Leyo 22:59, 8. Dez. 2014 (CET)
Hat mal jemand mit Zugriff auf SciFinder dort nachgeschaut ? Rjh (Diskussion) 09:20, 13. Feb. 2015 (CET)
Habe die Nummern nachgetragen. Patrick (Diskussion) 16:07, 1. Mär. 2015 (CET)
Cool. Vielen Dank! --Mabschaaf 16:11, 1. Mär. 2015 (CET)
Der Setzer dieses Bausteins ist der Ansicht, diese Diskussion sei erledigt. Sie wird daher nach drei Tagen automatisch in das Archiv verschoben. Bist Du der Ansicht, diese Diskussion sei noch nicht erledigt, so scheue Dich nicht, diesen Baustein durch Deinen Diskussionsbeitrag zu ersetzen! ----Mabschaaf 16:11, 1. Mär. 2015 (CET) Erledigte Diskussion

Nicht mehr lesenswerte bzw. exzellente Artikel[Bearbeiten]

Aufgrund des Abschnitts Wikipedia:Redaktion_Chemie/Qualitätssicherung#Alkane kommt bei mir ein Thema hoch, dass wir nun doch mal ernsthaft besprechen sollten. Leider gibt es m.E. weitere Artikel, die nur noch sind:

Siehe auch: Wikipedia:Redaktion Chemie/Liste ausgezeichneter Artikel

Wir sollten uns eingestehen, hier das evtl. zu bereinigen, d. h. zur Abwahl zu stellen. Gold ist m. E. fast ein Fass ohne Boden. Barium kann man mit einigem Einsatz wieder auf  Lesenswert bringen (vgl. Strontium). Viele Grüße --JWBE (Diskussion) 17:46, 9. Dez. 2014 (CET)

Ich bin ebenfalls der Meinung, dass uns Artikel mit Auszeichnung, welche diese nicht verdienen, schlecht anstehen. Eine Neubewertung unter WP:KALP wäre daher wohl sinnvoll. Ich schlage aber vor, die Artikel dort nacheinander einzustellen.
Da Orci aktuell wenig aktiv ist, bist du praktisch der einzige, der sich intensiv mit Elementartikeln auseinandersetzt. --Leyo 01:50, 12. Dez. 2014 (CET)
Ich werde wohl mit dem Artikel Barium anfangen, exzellent ist er auf keinen Fall mehr. Zudem ist er weniger ausführlich und ausgearbeitet als der im Jahr 2011 als lesenswert ausgezeichnete Artikel Strontium. Damit hat man einen guten Vergleich. Es ist jedoch denkbar, Barium wieder auf lesenswert zu bringen (vielleicht im Laufe des Jahres 2015). --JWBE (Diskussion) 10:22, 12. Dez. 2014 (CET)
Styrol, Ameisensäure, Ethen, Anthocyane wie Anthocyanidine keine Auszeichnung . --Drdoht (Diskussion)

Vielleicht sollte "Barium" als Beispiel eines exzellenten Artikels von der Portalseite genommen werden. Gruss, Linksfuss (Diskussion) 21:25, 25. Dez. 2014 (CET)

Barium ist nun abgewählt. --mfb (Diskussion) 23:42, 1. Jan. 2015 (CET)

Vor einer Neubewertung sollte das Ansinnen auf den jeweiligen Artikeldiskussionsseiten gemeldet und die Hauptautoren informiert werden. --Leyo 00:08, 2. Feb. 2015 (CET)

Änderung von Gefahrguteinstufungen u.a. für Styrol und Formaldehyd[Bearbeiten]

Nur zur Kenntnis, falls relevant für euch: 6. ATP der CLP-Verordnung veröffentlicht Gruß -- Achim Raschka (Diskussion) 10:55, 18. Dez. 2014 (CET)

Siehe dazu Wikipedia:Richtlinien Chemie#GHS-Kennzeichnung. --Leyo 01:14, 19. Dez. 2014 (CET)

Gemäss PDF sind folgende Artikel betroffen:

--Leyo 01:28, 9. Feb. 2015 (CET)

Stellt sich wieder die Frage wann und wie wir das einpflegen, da die Regelung ja erst am 1. April 2015 in Kraft tritt. Zum Beispiel wie wir eine Fußnote als Hinweis unterbringen. Rjh (Diskussion) 07:32, 9. Feb. 2015 (CET)
Naheliegend wäre für mich, die Änderung am 1. April einzuarbeiten. Erst dann ist die Kennzeichnung verpflichtend. - Nachtrag: Übrigens sind die Änderungen der 5. ATP noch nicht vollständig bearbeitet, ich habe gerade mal bei PFOA nachgearbeitet. --Shisha-Tom (Diskussion) 09:02, 9. Feb. 2015 (CET)
Hm, dort stimmt nun halt der Einzelnachweis nicht mehr mit der GHS-Kz überein. --Leyo 11:29, 9. Feb. 2015 (CET)
Danke für den Hinweis. Jetzt ist eine aktuelle Quelle verlinkt. --Shisha-Tom (Diskussion) 13:14, 9. Feb. 2015 (CET)
Kann man irgendwie einen Hinweis für April setzen damit der Punkt dann wieder auftaucht ? Zwischenzeitlich kann man damit diesen Punkt hier schliessen. Rjh (Diskussion) 09:31, 13. Feb. 2015 (CET)

Colligation[Bearbeiten]

Ist das ein deutsches Wort? Ich habe es noch nie gehört, auch wenn ich mir schon öfter eine Alternative zu Rekombination gewünscht hätte.

Wenn kein deutschsprachiger Beleg aufzutreiben ist, müßte man das Ding aber wohl umbenennen, imho. Googeln hat nix gebracht, da gibts nur Wörterbucheinträge.

Gruß, --Maxus96 (Diskussion) 01:16, 31. Dez. 2014 (CET)

Ich lese das Wort zum ersten Mal und ist mir glaube ich im Studium nie untergekommen (oder ich habs erfolgreich verdrängt). Für mich ist das auch eine Rekombination. Im Übrigen finde ich das Beispiel im Formelschema auch sehr schlecht gewählt. --codc Disk 01:33, 31. Dez. 2014 (CET)
Hier noch ein Chemiker, dem das Wort völlig neu ist. Mein Studium liegt aber schon eine Weile zurück. Spontan hätte ich das auch Rekombination genannt.--Andif1 (Diskussion) 14:15, 31. Dez. 2014 (CET)
Ich dachte sofort an das lateinische Wort:
 Wiktionary: colligere – Bedeutungserklärungen, Wortherkunft, Synonyme, Übersetzungen
--JWBE (Diskussion) 14:29, 31. Dez. 2014 (CET)
Als Kolligation teilweise in deutschen Lehrbüchern zu finden; ich würde aber auch Rekombination bevorzugen. Gruss, Linksfuss (Diskussion) 15:04, 31. Dez. 2014 (CET)
+1 für Umbenennung in REKOMBINATION. MfG -- (Diskussion) 18:13, 1. Jan. 2015 (CET)
Mit "K", darauf hätte man kommen können. Ich bin für Verschieben auf Kolligation (Chemie). Aber Rekombination gehört auf jeden Fall als weitaus gebäuchlicherer Name auch in den Artikel. --Maxus96 (Diskussion) 20:08, 1. Jan. 2015 (CET)
Lieber auf Rekombination (Chemie) verschieben und Kolligation (Chemie) (da ziemlich ungebräuchlich) als Redirect. Gruss, Linksfuss (Diskussion) 21:04, 1. Jan. 2015 (CET)
P.S.: habe SLA auf Rekombination (Chemie) gestellt, um Lemma für Verschiebung freizumachen. Gruss, Linksfuss (Diskussion) 10:54, 4. Jan. 2015 (CET)

Ist jetzt verchoben auf Rekombination (Chemie). Erledigt? Gruss, Linksfuss (Diskussion) 13:31, 4. Jan. 2015 (CET)

Hm. Also ich habe zumindest schon mal in Kolligation noch einen BKH ergänzt.
Bezüglich Rekombination (Chemie) und Rekombination (Physik) stellt sich mir die Frage, ob sich das wirklich trennen lässt - in beiden Fällen geht es um die Rekombination von Radikalen, nur die Umgebungsbedingungen unterscheiden sich (Reaktionen/Plasma).
Hinsichtlich des Lemmas Rekombination (aktuell für Genetik, Gentechnik) wäre zu klären, ob dort nicht eher die Begriffsklärung (aktuell Rekombination (Begriffsklärung)) stehen sollte. Dass die Hauptbedeutung von „Rekombination“ in der Genetik liegt, kann ich zumindest spontan nicht erkennen.--Mabschaaf 14:15, 4. Jan. 2015 (CET)
Bzgl. BKL bin ich der gleichen Meinung, zentrale BKL bauen. In der Physik ist aber Rekombination (auch laut dem Artikel) eher nicht (oder nicht nur) auf Radikale bezogen, sondern auf Ionen. --Maxus96 (Diskussion) 18:41, 4. Jan. 2015 (CET)

links auf Colligation[Bearbeiten]

hier

wird auf Colligation/Rekombination verlinkt, es ist aber nicht (oder nicht eindeutig) die Radikalrekombination gemeint. --Maxus96 (Diskussion) 02:46, 3. Mär. 2015 (CET)

Kontaktspray, Kriechöl, Rostlöser: Hilfe![Bearbeiten]

Diese Artikel sind hinsichtlich Informationsgehalt, Informationsrichtigkeit und Informationszuverlässigkeit, einschließlich Verwirrung des Lesers und Eindruck auf den verständigen Leser eine Katastrophe. Ich wollte mich hier über Kontaktspray informieren, was das eigentlich ist, und wurde sofort auf Kriechöl weitergeleitet (!).

In dem Artikel geht es dann zu einem großen Teil um Rostlöser, obwohl der Artikel dauernd selber erwähnt, daß Kriechöl mit Rostlöser größtenteils disjunkt ist.

Kontaktspray ist zwar laut einem mir persönlich bekannten Elektroingenieur zwar schon "als Öl spezifiziert" (da ging es um elektrische Leitfähigkeit, von wegen "austrocknen lassen" und "Rückstände" und so), aber ich kann eigentlich nicht sagen, daß es schmiert.

Leider fehlen mir die Fachkenntnisse, um dieses Chaos zu bereinigen. Mehr als das folgende Bißchen Vorarbeit kann ich leider nicht machen. Fühlt sich (bitte, bitte) dennoch jemand angesprochen?

  • Kontaktspray (derzeit -> Kriechöl) - bräuchte definitiv einen eigenen Artikel (Was es wirklich ist, Eigenschaften, Zusammensetzung, Stoffe, tatsächliche Leistungsfähigkeit, Gefahrhinweise, Geschichte usw. - oder erstmal überhaupt was, was in Qualität und Menge soweit ausreicht, daß es nicht gleich von siebzehnjährigen Administratoren gelöscht wird. (Was waren das noch für Zeiten, als in der de:WP noch stubs erlaubt waren. Seufz.))
  • Kriechöl - besagtes Chaos
  • Kommentare zu Kriechöl, die das Chaos bereits zum Teil gut aufspießen
  • Rostlöser (derzeit -> Kriechöl) - indirekt besagtes Chaos, bräuchte zumindest etwas Aufklärung darüber, was es ist und wie es sich von Kriechöl unterscheidet (oder eben auch doch tatsächlich nicht unterscheidet)

Angrenzende Artikel:

Suchergebnisse:

Leidende "kollegiale" Grüße, 217.81.179.159 23:14, 17. Jan. 2015 (CET)

Caramba, das wird nicht einfach. Kriechöl scheint so etwas wie ein Übersichtsartikel zu sein; könnte man zwar in die Einzelartikel "zerschlagen"; so schlecht sind die Themen aber nicht dargestellt. Schwierig. -- Linksfuss (Diskussion) 23:30, 17. Jan. 2015 (CET)
Danke für die Aufnahme und für das hinreißende Wortspiel (Caramba) ! 217.81.179.159 23:52, 17. Jan. 2015 (CET)
Ralf Roletschek dürfte sich auf der technischen Seite mit der Thematik auskennen. --Leyo 23:38, 17. Jan. 2015 (CET)
WD40 und Kriechöl hab ich grad schon mal etwas aufgeräumt.Sollte man der kompletten Verwandtschaft mal einen QS-Aufkleber verpassen? --Maxus96 (Diskussion) 23:58, 17. Jan. 2015 (CET)
Dafür! (Als - auch langjährige - IP verteile ich normalerweise selbst keine QS-Aufkleber :-) 217.81.179.159 00:36, 18. Jan. 2015 (CET)
Das "Aufräumen" war einfach nur Löschen mit unzutreffender Begründung. Man kann Kriechöle, WD-40, Rostlöser, Ballistol usw. nicht in Schubladen stecken, jedenfalls nicht aus technischer Sicht. Selbst wenn WD-40 chemisch fast reines Petroleum sein sollte, es wirkt anders. Das haben tausende Mechaniker versucht, das ist an zahlreichen Stellen nachzulesen. Wenn festsitzende Schrauben zu lösen sind, WD-40 nicht hilft, dann hilft keine Chemie mehr, das kann man bei Sheldon Brown nachlesen. Ballistol ist auch ne Sache für sich, das kann man sogar trinken (naja, wirkt abführend) - das funktioniert als Brünieröl, Sattelfett, Waffenöl, Ersatz für Vaseline, Kriechmittel und vieles andere mehr. Caramba ist ein (fast) reiner Rostlöser und wurde mit Erscheinen von WD-40 weitgehend aus den Werkstätten verdrängt. Gleichzeitiges Benutzen von Bremsenreiniger und Kettenfließfett fettet Stellen, die eigentlich unzugänglich werden, es entsteht ein Fließmittel, was sich später wieder in niedrigviskoses Fleißfett verwandelt. "TRS Plus" ist ein Industriemittelchen, ähnlich wie WD-40, nur bessere Schmierwirkung. Und Lubritech Ferroform hat den Ruf, selbst verklebte Metalle zu lösen, das kann ich nicht einschätzen. Die Massenware (gibts von jedem bekannten Hersteller) ist dann wiederum ein Mischmasch aus Allem. Da steht meistens "Molybdän" auf der Packung, weil irgendwie verbreitet wurde, das muß drin sein. In Wirklichkeitr wird es nur bei Verbrennungsmotoren gebraucht und die Wirkung ist zumindest umstritten.
Man kann also nicht sagen: A, B und C sind Kriechöle, D und E sind Schmierstoffe und F ist nur Kontaktspray. Die Übergänge sind sehr fließend. Selbst die Geschichte mit Cola als Rostlöser ist keineswegs nur eine Legende sondern wird benutzt, da Cola so wunderbar einfach zu beschaffen und billig ist.
Aber wenn die Artikel Bauklötzer bekommen, dann dürfen andere dort tätig werden. --M@rcela Miniauge2.gif 16:07, 18. Jan. 2015 (CET)
Die Behauptungen in WD-40 waren völlig unlogisch, ich habe sie einzeln mit Begründung entfernt. In WD-40 etc. ist nichts drin, was irgendwie Rost lösen könnte. Es ist auch keine Chemie, sondern reine Kriech- und Schmierwirkung. Molybdän(disulfid) bewirkt, daß z.B. Schrauben an erhitzen Bauteil nicht festfressen. Es verdampft nicht und wirkt an wenig bewegten Teilen (eben Schrauben, "Montagespray" heißt es manchmal) als (halbwegs dauerhaftes) Schmiermittel.
(Wer solide Belege hat darf mich gern von was anderem überzeugen. Und daß verdünnte Phosphorsäure Rost löst, ist klar, nur ist in den "Rostlösern" keine Säure drin. Es würde die immer auch beworbene Korrosionsschutzwirkung ad absurdum führen.) Gruß,--129.13.72.197 06:35, 19. Jan. 2015 (CET)

Kontaktspray[Bearbeiten]

Hier: Kriechöl#Kontaktspray. Da steht was von "Additiven die Korrosionen lösen". Ist das nicht Humbug? Kontaktspray muß doch möglichst schnell rückstandslos verdampfen. (Hm, WD-40 funktioniert als Kontaktspray, und das verdampft nicht so schnell vollständig. Wird sogar beworben: "Hält elektrische und elektronische Mechanismen frei von Feuchtigkeit und verhindert so Kriechströme." Punkt 5)

Der Vorteil gegenüber Druckluft ist imo, daß der unlösliche Dreck weggeschwemmt wird statt aufgewirbelt, und sich dann in irgendwelchen hoffentlich unwichtigen Ecken ablagert und mit dem löslichen Dreck (Lötfett, Schmierung etc.) zu einem festen Klump zusammensintert. Aber wo gibts Belege für sowas? --129.13.72.197 07:07, 19. Jan. 2015 (CET)

Semax[Bearbeiten]

Übertrag von meiner Benutzerdiskussionsseite:
---
Hallo! Dein verschieben des Artikels, mit der Begründung "Kein Handelsname als Lemma" ist an sich richtig, jedoch wird der Stoff auch in Russland als Semax bezeichnet. Viele Medikamente werden dort allerdings direkt unter dem Stoffnamen verkauft. Beispiele: Bromantane, Afobazole, Phenibut, Tenoten, Noopept. Meine Beschreibung ist leider nicht komplett ersichtlich, allerdings habe ich den letzten Teil da gar nicht erwähnt. Also bitte nicht wieder umbenennen --Neogenic (Diskussion) 03:11, 16. Jan. 2015 (CET)
---
Es mag schon sein, dass bequemerweise das Heptapeptid selbst auch als Semax bezeichnet wird, das ändert aber nichts daran, dass der Stoff eine nachweislich gebräuchliche wissenschaftliche Kurzbezeichnung (Trivialname) oder eine systematische Bezeichnung (USAN, WHO, IUPAC) haben dürfte bzw. sollte. Im russischen Vidal steht zur Zusammensetzung, die Nasentropfen СЕМАКС enthielten Methionyl-glutamyl-histidyl-phenylalanyl-prolyl-glycyl-prolin (метионил-глутамил-гистидил-фенилаланил-пролил-глицил-пролин); ebefalls wird der Stoff in der im Artikel erwähnten Liste essentieller und lebenswichtiger Medikamente so genannt (Seite 80, mittlere Spalte, vierter Name von oben). Die Begründung, in Russland würden viele Medikamente direkt unter dem Stoffnamen verkauft, ist m.E. kein Beleg für die „Echtheit“ des Stoffnamens, gleiches ist hierzulande auch möglich und wird umfänglich bei Generika praktziert.
Wie sehen andere das? Kann man Semax als „eingebürgerten Trivialname“ ansehen?--Benff 00:41, 18. Jan. 2015 (CET)

„In der engl. wissensch. Literatur wird das Peptid schlicht Semax genannt“ ist zwar ein guter Hinweis, aber keine hinreichende Begründung. In der "engl. wissensch. Literatur" finden sich häufig Ungenauigkeiten zwischen Markenname des Fertigprodukts und Stoffbezeichnung. Dann ist beispielsweise (hier: Imatinib/Glivec) auch das molekulare Modellieren einer Fertigarzneimitteltablette in die Bindungstasche eines Zielmoleküls möglich. Zurück zum Thema. Um noch mehr Verwirrung zu stiften, bezeichnet das Toxnet des NIH das Peptid als "ACTH (4-7), pro-gly-pro-" --Svеn Jähnісhеn (Diskussion) 10:10, 26. Jan. 2015 (CET)

So Verwirrung stiftend finde ich den Toxnet-Namen nicht, er ist ja im Artikel bereits erwähnt und in der Einleitung sogar dargestellt, wie er zustande kommt... Ich hätte auch kein Problem damit, Pro-Gly-Pro-ACTH (4-7) als Lemma zu nehmen, ist jedenfalls besser als ein proprietärer Name. --Benff 14:59, 27. Jan. 2015 (CET)
Wie lautet denn der INN? Grüße, --07:30, 20. Feb. 2015 (CET)
Es hat keinen. --Benff 01:25, 22. Feb. 2015 (CET)
Hmm, also unhandliche gegen proprietäre Bezeichnung. Dann würde ich Pro-Gly-Pro-ACTH (4-7) wählen, Grüße, --Ghilt (Diskussion) 23:24, 25. Feb. 2015 (CET)

Unterkategorien Namensreaktionen[Bearbeiten]

Ich wollte mal in die Runde fragen, ob es für sinnvoll erachtet wird, die Kategorie:Namensreaktion in Unterkategorien zu untergliedern. Aktuell dient die Kategorie ja nur der Auflistung aller Reaktionen, was aber bereits in der Liste von Namensreaktionen gegeben ist. Bei einer weiteren Unterteilung würde es also nicht unübersichtlicher werden.

Vorteil einer Untergliederung wäre, dass leichter nach bestimmten Reaktionen gesucht werden könnte. Beispielsweise könnten Swern-Oxidation und Pfitzner-Moffatt-Oxidation beide in die Unterkategorie "Oxidation eines Alkohols bis zum Keton/Aldehyd", was wieder eine Unterkategorie von "Oxidation eines Alkohols" sein könnte, etc. Der Vorteil ist, dass man im Gegensatz zu einer Liste eine Reaktion leicht in mehrere Unterkategorien einordnen könnte.

Mabschaaf wies übrigens darauf hin, dass eine neuere Version der Liste unter Benutzer:Orci/Namensreaktionen zu finden ist. Viele Grüße --Minihaa (Diskussion) 17:38, 2. Feb. 2015 (CET)

Die Namensreaktion-Kategorie sollte m.e. nicht weiter unterteilt werden, eine Kategorisierung nach Reaktionstyp gibt es schon parallel dazu (z.B. Kategorie:Umlagerung). Das ist viel sinnvoller so, da es von Reaktionstypen sowohl Reaktionen mit als auch ohne Eigenname gibt. Es gibt sicher noch nicht für alle Typen Kategorien, die sollten aber auch nicht zu speziell sein (wie z.B. "Oxidation eines Alkohols bis zum Keton/Aldehyd" es wäre). Ab ca. 10 Artikeln pro Typ ist eine Kat sinnvoll. --Orci Disk 20:02, 2. Feb. 2015 (CET)
+1, aber wenn ich jetzt durch meine alten OC-Bücher blättern würde, fände ich bestimmt allein fünfzehn Reaktionen, die Alkohole zu Ketonen oder Aldehyden oxidieren. Schätz ich mal. Der Katname wäre etwas sperrig, aber imo durchaus sinnvoll. Gruß, --Maxus96 (Diskussion) 22:40, 2. Feb. 2015 (CET)
Bei Namensreaktionen wird wohl meist alphabetisch gesucht und so ist eine Kategorie sinnvoller. Bei der aktuellen oder von Orci geplanten Liste der Namensreaktionen kann man ja sortierbare Spalten einrichten, so dass man auch andere Auflistungen erzeugen kann.--Steffen 962 (Diskussion) 09:48, 3. Feb. 2015 (CET)

@Orci: Das stimmt, ich denke auch, dass es sinnvoller wäre, nicht die Namensreaktionen, sondern alle Reaktionen in Kategorien wie etwa Kategorie:Umlagerung einzuteilen. Bisher finde ich die Unterkategorien der Kategorie:Chemische Reaktion recht dünn. Es könnte ausgebaut werden, indem man:

@Steffen 962: Listen mit sortierbaren Spalten haben auf jeden Fall auch ihre Berechtigung und Nutzen, dürften für komplexere Einteilungen wie hier über nicht anwendbar sein. --Minihaa (Diskussion) 11:24, 4. Feb. 2015 (CET)

Zu kompliziert und vielschichtig sollte man das Reaktions-Kategoriesystem m.e. nicht machen. Eine Kategorisierung nach drei oder mehr Kriterien finde ich übertrieben und unnötig. Ich habe mich bei der Einteilung der Reaktionen auch immer sehr schwer getan, weil es 1. viele Typen für relativ wenige Artikel gibt, was viele Mini-Kategorien bewirken würde und 2. es reichlich sehr komplexe Reaktionen gibt, bei denen mehrere Reaktionstypen eine Rolle spielen, mehrere Bindungen gebildet werden usw. Die kann man dann kaum sinnvoll einer Kategorie zuordnen.
Ich würdedaher nur sehr behutsam für eindeutige Typen Kategorien anlegen und mich auf die wichtigsten beschränken.
Sortierbare Spalten gehen mit der aktuellen Liste, bei der Neufassung auf meinen Unterseiten würde das keinen Sinn mehr geben, da auf Grund der Datenmengen eine Verteilung auf Unterseiten nach Anfangsbuchstabe nötig ist. --12:19, 4. Feb. 2015 (CET)
Ich denke, dass man in der englischen Wikipedia sieht, dass auch komplexe Reaktionen auf ein einfaches Ergebnis heruntergebrochen werden können (wie zum Beispiel die Bildung einer Kohlenstoff-Kohlenstoff-Bindung) und dann ohne Probleme in die entsprechende Kategorie eingeordnet werden können. Wenn man dann nach Reaktionen zur Bildung einer C-C-Bindung sucht, ist eine solche Kategorie eine deutliche Hilfe. Ich wollte mir letztens den Überblick verschaffen, welche Alternativen es noch zur Swern-Oxidation gibt.
Welche Kategorien wären denn aus deiner Sicht sinnvoll, um konkret zu werden? Ich habe oben ja einige Vorschläge gemacht. --Minihaa (Diskussion) 19:12, 5. Feb. 2015 (CET)

Um zur Eingangsfrage zurück zu kommen: Ich bin strikt gegen eine Aufteilung der Kat:Namensreaktion. „Namensreaktion“ ist ein stehender Begriff, dort erwartet man alle selbigen zu finden. Es kann also nur parallel dazu um die Zuordnung einzelner Reaktionen in weitere, den Reaktionstyp beschreibende Kats gehen, also eine weitere Unterkategorisierung der Kategorie:Chemische Reaktion - aber da gibt es ja schon einige. Ich würde da aktuell keinen Handlungsbedarf sehen, auch um eine Atomisierung der Kats zu vermeiden. --Mabschaaf 20:02, 5. Feb. 2015 (CET)

@Mabschaaf: Ich habe oben doch schon geschrieben, dass Orci Recht hat und es besser Unterkategorien der Kategorie:Chemische Reaktion geben sollte. In en:Category:Carbon-carbon bond forming reactions finden sich 107 Reaktionen, würdest du da wirklich von "Atomisierung" sprechen? --Minihaa (Diskussion) 12:03, 6. Feb. 2015 (CET)
Also von diesen Kategorien für Reaktionen nach entstehender Bindung halte ich gar nichts, bei ca. der Hälfte der organischen Reaktionen dürfte es irgendwie das Ziel sein, eine C-C-Bindung zu schaffen und die Kategorie sagt nichts darüber aus, was sonst noch dafür nötig ist. Und irgendwelche Kohlenstoff-Heteroatom-Bindungs-Knüpfungen dürften in fast jeder org. Reaktion vorkommen, das bringt auch nichts. Was man machen könnte, wäre für weitere Reaktionstypen (neben den schon vorhandenen wie Umlagerung oder elektrophile Substitution) Kats anlegen, also bsp. eine Kategorie:Kondensation oder Kategorie:Elektrophile Addition o.ä. Natürlich abhängig davon, was es jeweils für Artikel gibt. --Orci Disk 12:53, 6. Feb. 2015 (CET) PS: ich finde das en-Katsystem da wie so häufig in en nicht besonders gut und eher in Ansätzen steckengeblieben.

Für die Kategorie:Kondensation gibt es: Acyloin-Kondensation, Aldolkondensation, Biginelli-Reaktion, Claisen-Kondensation, Combes-Chinolinsynthese, Dieckmann-Kondensation, Kondensationsreaktion, Doebner-Miller-Reaktion, Erlenmeyer-Synthese, Friedländer-Chinolin-Synthese, Knoevenagel-Reaktion, Madelung-Indolsynthese, Robinson-Gabriel-Synthese, Negishi-Kupplung, Pechmann-Reaktion, Pellizzari-Reaktion, Perkin-Reaktion, Pfitzinger-Reaktion, Pictet-Spengler-Reaktion, Skraup-Synthese, Thorpe-Ziegler-Reaktion, Ullmann-Reaktion, Urech-Hydantoinsynthese, Wurtzsche Synthese, Yamaguchi-Verfahren. Spricht etwas dagegen? --Minihaa (Diskussion) 14:18, 18. Feb. 2015 (CET)

Spricht m.e. nichts dagegen. --Orci Disk 14:39, 23. Feb. 2015 (CET)
Weitere Kategorien und Details schlage ich vielleicht später noch einmal vor, analog zu deinem Vorschlag, Orci. Ansonsten für mich erstmal --Minihaa (Diskussion) 18:38, 23. Feb. 2015 (CET)

erledigt Erledigt

p-Brom-Benzylhydrazide[Bearbeiten]

Hallo ihr,
ich bastle mich gerade in einer Baustelle durch die Biografie des Chemienobelpreisträgers Edward Calvin Kendall und versuche herauszufinden, was er in seiner Bachelor-/Masterarbeit gemacht hat - das Ergebnis war diese Publikation. Frage: Gibt es eine andere etablierte Schreibweise für p-Brom-Benzylhydrazide oder haben wir evtl. gar bereits einen Artikel darüber? Gruß -- Achim Raschka (Diskussion) 07:54, 3. Feb. 2015 (CET)

Einen Artikel oder Trivialnamen gibt es nicht dafür. Der korrekte deutsche Name ist entweder p-Brombenzohydrazid oder 4-Brombenzohydrazid. Links: [1], [2]. Viele Grüße --Orci Disk 09:44, 3. Feb. 2015 (CET)
Die Hydrazide gibt's immerhin. Gruss, Linksfuss (Diskussion) 20:50, 6. Feb. 2015 (CET)
-benzoylhydrazid ginge auch noch. -benzylhydrazid ist falsch, denn das Molekül enthält keine Benzylgruppe. Das entsprechende Molekül wäre auch kein Hydrazid, sondern ein Hydrazin. Damals sah man das wohl anders... Gruß --FK1954 (Diskussion) 18:30, 25. Feb. 2015 (CET)

Xylitol[Bearbeiten]

Moin, ist das so korrekt mit dieser Bearbeitung? Wenn ja, dann sollte der Artikel auch auf Xylit verschoben werden. 2003:4D:2C5E:D840:D4F5:D76D:872C:6BB1 11:29, 7. Feb. 2015 (CET)

Nach Google Ngram erscheint Xylit plausibel.--kopiersperre (Diskussion) 13:23, 7. Feb. 2015 (CET)
  • Siehe Sorbit, Maltit, Erythrit, Mannit, aber Lactitol. Beides ist möglich, aber in Wikipedia sollte es einheitlich gehandhabt werden. -it heißen die Stoffe im Lebensmittelbereich [3], hingegen -itol im Pharmabereich (Xylitol, Sorbitol, Mannitol, Maltitol, Erythritol, Lactitol...). Da für die überwiegende Zahl der Stoffe hier die -it-Namen verwendet werden, sollte man es für Xylit(ol) und Lactit(ol) ebenso halten. --Benff 14:09, 7. Feb. 2015 (CET)
Hm, Xylit ist eine Begriffsklärung, da Xylit auch noch eine Bezeichnung für Schieferkohle ist. Und nun? --Benff 20:42, 15. Feb. 2015 (CET)

Langlink-Konflikt[Bearbeiten]

Vielleicht bin ich zu doof, aber ich verstehe einfach nicht, wie die auf Merlbots Wartungsliste ganz unten genannten Langlink-Konflikte gelöst werden können. Auch die Erläuterung, die bei Klick auf das Grafik-Symbol zugänglich ist, hilft mir nicht. Mal ein Beispiel - und dieses bitte jetzt nicht fixen, ich möchte gerne nachvollziehen können, was zu tun wäre, ohne dass es jetzt schon ein anderer gemacht hat. Dort steht:

Der Artikel en:Cassella Farbwerke Mainkur Aktiengesellschaft ist eine Weiterleitung auf en:Cassella; in keinem der drei Artikel existieren noch „manuelle“ Interwikilinks, d.h. die komplette IW-Verlinkung läuft über Wikidata. Wo existiert nun ein Konflikt, ein Falscheintrag oder eine Falschzuordnung? Ping an Benutzer:Merlissimo, vielleicht wäre es ja hilfreich, die Darstellung in der Liste und/oder die Erläuterung auf Hilfe:Internationalisierung#Wartung_der_Interwiki-Links anzupassen/auszubauen.--Mabschaaf 12:34, 8. Feb. 2015 (CET)

Mir geht's mit etlichen Einträgen ähnlich, etwa bei folgendem:
Ich frage mich auch, ob dies Probleme sind, die wir lösen müssen. --Leyo 15:47, 8. Feb. 2015 (CET)
Der Fall mit Casella war ein Datenbankfehler. Ich habe gestern, nachdem ich das hier gesehen hatte, meinen Bot tausende NullEdits machen lassen (hier und auf fremden Wikis), damit für heute sicher ist, dass der Inhalt werde Wartungsliste wieder stimmt. der Prozess läuft aber noch.
Meine Nachfrage bei den WikiData-Leuten heite ergab, dass die im Januar HHVM auf wikidata getestet haben und dabei der Dispatcher-Thread (d:Special:DispatchStats) nicht mehr funktioniert hat. Daher die fehlenden Updates.
Es gibt ja zwei Wartungslisten "Langlink-Konflikt" und "Langlink-Konflikt (Fortsetzung)". Erste wird auf allen Portalen angezeigt und beinhaltet nur einfachere Konflikt-Fälle und auch nur BKS und Personen, wo der Fall schnell klar sein sollte. Die Zweite beinhaltet auch alle anderen Konflikte. Diese habe ich nach einer Anfrage bzgl. lokale Langlinks von Leyo erstellt (Wikipedia:Bots/Anfragen/Archiv/2014-2#Artikel mit Interwiki-Links im Quelltext zuständigen Projekten zuordnen).
Ich denke heute Nachmittag ist der Bot mit den NullEdits durch, dass mache ich ein Update und ich wir können die Problemfälle gerne diskutieren. Merlissimo 12:52, 9. Feb. 2015 (CET)
Der Datenbankausfall heute Mittag hat hiermit zu tun. Jetzt könnt ihr auch überlegen wer Schuld ist: Mabschaaf wegen dem finden des Fehler auf meiner Wartungliste? Ich, weil ich die Ursache ergründet und an die wikidata-Leute gemeldet habe? Hoo, der daraumhin die Fehlkonfikuration bei wikdiata geändert hat? Oder Sean, weil die WMF-DB keine vier Million Update auf einmal schafft. ;-) Merlissimo 13:41, 9. Feb. 2015 (CET)

@Merlissimo: Selbst nachdem die Fehleinträge in der Liste nun weg sind finde ich den Rest immer noch äußerst komplex und nahezu nicht bearbeitbar - zumal ich jetzt seit ungefähr einer Stunde an verschiedenen Beispielen versuche, die gewählte Symbolik mit ⇉ und ⇄ zu verstehen. Einfacher wäre mM in der Liste die unterschiedliche Fälle nicht zu mischen:

  • Das deLemma hat einen manuellen IW, das dem deLemma zugeordnete Wikidata-Objekt hat aber keinen Eintrag für die manuell verlinkte Sprache; aber der mit dem manuellen IW verlinkte Artikel ist in einem anderen Wikidata-Objekt schon verlinkt, Beispiel:
  • In einer der Sprachversionen sind manuelle IWs enthalten, Beispiel:
  • In mehreren Sprachversionen sind manuelle IWs enthalten, Beispiel:

Bei den beiden letzteren Beispielen wird nicht deutlich, wo überall manuelle IWs zu suchen sind und ob es ggf. mehrere zugeordnete Wikidata-Datenobjekt gibt (wie Heizöl mit d:Q912452 und Schweröl mit d:Q214199).

Ich bin da sehr ratlos. Dass die Liste praktisch kaum abnimmt, spricht ja für sich.--Mabschaaf 13:13, 15. Feb. 2015 (CET)

Schmelzpunkt, Siedepunkt, Tripelpunkt bei Argon[Bearbeiten]

Vor kurzem wurde ich von einer IP wegen einer Werteänderung bei Argon angesprochen. Nun habe ich genauer hingesehen und die Daten müssten m.E. genauer nachgeprüft werden. Grund ist eine Kollison mit dem Tripelpunkt. Da Schmelz- und Siedepunkt recht nahe beieinander liegen, ist zwangsläufig der Tripelpunkt nicht weit weg. Im CRC, 90. Aufl., Seite 4-49 ist als mp. −189,36 °C bei 69 kPa angegeben (Das sind 83,8 K). Hier wurde der Tripelpunkt verwendet, ein Schmelzpunkt unter Normaldruck wurde nicht angegeben. Dieser Wert wurde in Folge auch auf Seite 4-4 im Beschreibungstext zu Argon verwendet. Die Werte bei NIST ( http://webbook.nist.gov/cgi/cbook.cgi?Source=1969GOS%2FMCC0R&Units=SI&Mask=7 ) variieren auch: Hier ist Tfus gleichfalls mit 83,8 K angegeben. Ein echter Schmelzpunkt ist damit nicht verfügbar. Das Gesamtzahlengefüge stimmt also nicht. Viele Grüße --JWBE (Diskussion) 14:30, 8. Feb. 2015 (CET)

Hilft das [4] was ? Rjh (Diskussion) 17:17, 8. Feb. 2015 (CET)

Jahrestreffen 2015[Bearbeiten]

Wikipedia:Redaktion Chemie/Treffen/2015/Planung ist noch sehr leer. Ich fand den Vorschlag mit Hamburg sehr gut und würde mich an der Organisation beteiligen. Grundsätzliche Frage ist ob wir zum Frühjahrsrythmus zurückkehren wollen oder oder eher wieder im Herbst. Brückentage gibt diese Jahr nicht. --Saehrimnir (Diskussion) 14:42, 13. Feb. 2015 (CET)

Peptide[Bearbeiten]

Da Peptide irgendwo zwischen kleinen Molekülen und Proteinen angesiedelt sind, stellen sich für mich (gerade im Zusammenhang mit der ausstehenden Kategorisierung von Teduglutid) ein paar Fragen, wie wir das generell handhaben sollten:

  • Ist eine Chemobox oder eine Proteinbox besser geeignet oder bis zu welcher Peptidlänge sollte es eine Chemobox und ab welcher eine Proteinbox sein?
  • Bis zu welcher Länge ist eine Kategorisierung nach Strukturelementen noch sinnvoll (es sind ja sowieso die immer gleichen 20 Aminosäuren - falls es sich nicht um Peptide mit modifizierten Aminosäuren handelt)
  • Wie sinnvoll ist eine Abbildung wie die derzeit in Teduglutid verwendete (Datei:Teduglutide.png)? Sollte ab einer bestimmten Anzahl Aminosäuren anstelle einer Strukturformel nicht eher die Aminosäuresequenz angegeben werden?
    • Falls gewünscht: Sollte das eher im Dreibuchstaben- (hier: His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp) oder Einbuchstabencode (HGDGSFSDEMNTILDNLAARDFINWLIQTKITD) erfolgen?

Viele Grüße --Mabschaaf 15:20, 19. Feb. 2015 (CET)

Hallo Mabschaaf, zu Punkt 1: unter Peptid ist als obere Grenze zu Proteinen 100 AS angegeben (m.E. eine mehr oder weniger sinnlose Einteilung), ich würde als untere Grenze das Dipeptid sehen. Ob eine Proteinbox allerdings dort und bei isopeptidbindungsverknüpften Aminosäuren wie bei einigen bakteriellen Cyclopeptiden auch Sinn macht, bin ich mir noch nicht sicher. ad 2: nicht, außer Sondergruppen wie die posttranslationalen Modifikationen. ad 3: wie viele Aminosäuren bekommt man noch einzeln gut dargestellt? Im Bild ist es m.E. gerade noch akzeptabel. Die meisten meiner Kollegen verwenden aus Faulheit nur den Einbuchstabencode, aber solange es im Artikel homogen verwendet wird, ist es m.E. auch der 3er ok. Grüße, --Ghilt (Diskussion) 15:37, 19. Feb. 2015 (CET)
Komplettdarstellung von mehr als Tripeptiden ist unüblich. Es ist nur dann üblich, wenn man auf die Chemie einer ganz speziellen Tertiärstruktur im Peptid hinweisen will (Beispiel Ciclosporin). Sonst 3er-Code oder noch besser ( => Myotoxin) Einbuchstaben-Code. Argumentation: Die Leute, die sich für das Detail der genauen Sequenz von Peptiden interessieren, kennen auch den Einer-Code.
Als Box die Protein-Box, denn der Übergang ist fliessend (aka bis wohin würde man bei Peptiden die ChemBox nehmen - und ab welcher Länge die Protein-Box?). Und: Peptide bilden ebenso Familien wie Proteine.
Neben dem engl. polypeptide setzt sich eigentlich immer mehr durch, dass peptide das ist, was man nach enzymatischem oder physikalischen (MS) Abbau bekommt (peptide map usw.). FIFTY SHADES … nil nisi bene 15:57, 19. Feb. 2015 (CET)
Moin, moin, stimme Ghilt zu, bevorzuge den 3er-Code (dann aber auch in Box und Fließtext). Viele Grüße -- (Diskussion) 07:57, 20. Feb. 2015 (CET)
Ich würde das gerne soweit klären, dass ein paar Stichpunkte in die Richtlinien übertragen werden können.
@Ghilt: Deine Antwort lässt mich etwas ratlos zurück: Wenn ich Dich richtig verstehe, würdest Du für jedes Peptid ab Dipeptid direkt eine Proteinbox nehmen? Ich schlage da eher die Grenze bei Tripeptid vor, sonst aber: ok.
Teilstruktur-Kats: i.d.R. keine, nur besondere Gruppen
Abbildung:
  • bis Tripeptid (d.h. in den Fällen, in denen noch die Chemobox Verwendung findet): Strukturformel;
  • bis (um mal eine Zahl zu nennen) ca. 30 Aminosäuren Dreibuchstaben-Code umschlossen von <code>-Tags (damit erfolgt eine Darstellung wie in meinem Eingangsposting) - Ausnahme: Spezielle Bindungsverhältnisse im Peptid, die eine graphische Darstellung zur Verdeutlichung sinnvoll machen; (Anmerkung dazu: Den Einbuchstaben-Code könnte man zusätzlich ebenfalls von Code-Tags umschlossen unter "Andere Namen" in die Box setzen)
  • bei längeren Peptiden Abbildungen der Sekundär-/Tertiärstruktur
Wäre das für alle akzeptabel?--Mabschaaf 18:21, 26. Feb. 2015 (CET)
  • +1 FIFTY SHADES … nil nisi bene 18:30, 26. Feb. 2015 (CET) Kleine Einschränkung: Die "Sequenz" (3er- oeder 1er-Code) unter "Andere Namen" ist eigentlich unüblich. Die Sequenz ist die Sequenz - und kein "Name". Sorry für die Verspätung... FIFTY SHADES … nil nisi bene 21:22, 26. Feb. 2015 (CET)
Nur eine kleine Anpassung, ansonsten einverstanden: vorzugsweise das PDB-Bild (bei allen Proteingrößen), wenn vorhanden. In diesem Fall könnte der 1er-Code auch unter "Andere Namen". Grüße, --Ghilt (Diskussion) 18:34, 26. Feb. 2015 (CET)
Seufz. Gerade festgestellt: In der Proteinbox gibt es kein Feld für "andere Namen"! Wurde das noch nie vermisst?--Mabschaaf 19:55, 26. Feb. 2015 (CET)
Schon, aber noch nicht umgesetzt, kann ich mal versuchen, Grüße, --Ghilt (Diskussion) 21:23, 26. Feb. 2015 (CET)
Wenn Du möchtest, gerne - ansonsten kann ich natürlich auch...--Mabschaaf 21:56, 26. Feb. 2015 (CET)
Vielen Dank, Du kannst das besser, bei mir würde es ein trial & error-Gefummel. Grüße, --Ghilt (Diskussion) 21:59, 26. Feb. 2015 (CET)
Done - und für LL-37 beispielhaft umgesetzt.--Mabschaaf 22:32, 26. Feb. 2015 (CET)
Und sieht gut aus, nochmals Danke und Grüße, --Ghilt (Diskussion) 23:48, 26. Feb. 2015 (CET)
Die Sequenz ist kein "anderer Name". Dann besser "Masse/Länge Primärstruktur" in 2 Boxes auftrennen und die Sequenz da unterbringen. FIFTY SHADES … nil nisi bene 08:53, 27. Feb. 2015 (CET)
Ok, aber nicht immer, denn bei kurzen Peptiden ist die Sequenz oftmals eine weitere typische Bezeichnung. Das Feld mit anderen Namen ist trotzdem sinnvoll, das war überfällig. Grüße, --Ghilt (Diskussion) 09:49, 27. Feb. 2015 (CET)
Dass die Peptidsequenz als Name verwendet wird - auch kurz - ist mir nicht geläufig. [http://www.peptideatlas.org/docs/PA_terms.php Hier wird erklärt, dass man einer Sequenz einen "Namen" in einer Datenbank zuordnet. Was spricht dagegen, systematische und Trivialnamen in einer Box - und die Sequenz in einer anderen unterzubringen. Sauber! FIFTY SHADES … nil nisi bene 10:51, 27. Feb. 2015 (CET)
Hier z. B. beim Glutathion (PMID: 21141850), ich habe aber nichts gegen ein eigenes Feld für die Primärstruktur. Grüße, --Ghilt (Diskussion) 11:02, 27. Feb. 2015 (CET)
Also es ist natürlich kein Problem, noch (ein) weitere(s) Feld(er) hinzuzufügen, aber irgendwie sollten wir vorher ein Gesamtkonzept haben. Wo sollte welche Information platziert werden und was geschieht mit den Informationen, die momentan in der Chemobox drin sind, wenn sie gem. dem oben beschlossenen auf die Proteinbox umgestellt wird (z.B. Leuprorelin)?--Mabschaaf 10:33, 27. Feb. 2015 (CET)
Hm, alle übernehmen? Oder alle übernehmen, die hier für sinnvoll erachtet werden? Grüße, --Ghilt (Diskussion) 11:02, 27. Feb. 2015 (CET)
Es ist schwierig, immer hin und her zu hupfen, um nachzusehen. Kann man nicht verschiedene Boxes hier abbilden - und dann wâhlt man sich 3 Probanden (kleines Peptid, längeres Peptid, kleines Protein) und sieht nach, was man da brauch? (auch ein Vergleich mit der en:WP könnte nützlich sein, aber die haben auch mehrere...) FIFTY SHADES … nil nisi bene 11:07, 27. Feb. 2015 (CET)
Verschiedene Boxen hier abbilden geht leider nur mit enormem Aufwand, weil jede extra programmiert werden müsste. Für die Positionierung der "anderen Namen" kann man im Artikel Teduglutid oder Leuprorelin im Bearbeiten-Modus einfach mal das Infobox Chemikalie durch Infobox Protein ersetzen und auf Vorschau klicken (die aufpoppenden Parameterfehler einfach ignorieren) - dann bekommt man eine Ahnung davon, wie unterschiedlich die Boxen sind und wie viele Informationen nicht 1:1 übertragbar sind. Falls wir also wirklich für alle Peptide >Tripeptid auf eine Proteinbox gehen wollen, müsste das gelöst werden.
Ich habe mich jetzt aber auch durch Dutzende Peptid-Artikel geklickt und dabei sehr häufig Uneinheitlichkeiten festgestellt. Das fängt mit den Lemmata an (oder gilt hier nicht, dass Gruppen ein Plurallemma haben?), Kategorien (hier werden prinzipiell Struktur- und Funktionskategorien gemischt, also mM sollte es eine Kategorie:Cyclopeptid, und, falls es genügend Vertreter gibt evtl. eine Kategorie:Isopeptid und eine Kategorie:Dipeptid, geben - die unabhängig von den Einordnungen in die Funktions-Kats Kategorie:Peptidhormon und Kategorie:Peptid-Antibiotikum sind) und vor allem Nicht-Nennung der AS-Sequenzen bei kleinen Peptiden. Da wäre wohl mal ein wenig aufzuräumen...--Mabschaaf 16:54, 27. Feb. 2015 (CET)
Entweder werden m.E. alle existierenden Paramter in die Proteinbox aufgenommen, was sie sehr aufblasen würde, oder wir verzichten auf die Erwähnung der Chemobox-Parameter bei der Umstellung auf eine Proteinbox. Mir ist beides recht. Bezüglich der Plurallemmata bin ich indifferent, da ist es m.E. ohnehin eine arbiträre Einteilung, von mir aus können alle Proteine und Peptide der Singularregel folgen. Die Sonderstuktur-Kategorien finde ich gut, weitere wären Kategorie:Glykoprotein, Kategorie:Ribonukleoprotein, Kategorie:Nukleoprotein und Kategorie:Proteolipid. Gibt es schon eine Liste mit Peptiden, die mit einer Primärstruktur zu ergänzen wären? Grüße, --Ghilt (Diskussion) 17:16, 28. Feb. 2015 (CET)
Je nachdem, wie viele es sind, könnte ich auch die Chemobox-Daten in den Fließtext einfügen. Grüße, --Ghilt (Diskussion) 15:07, 1. Mär. 2015 (CET)

Kältemittel[Bearbeiten]

Was haltet ihr davon alle Kältemittel mit einer R-Nummer in eine Kategorie:Kältemittel einzuordnen?--kopiersperre (Diskussion) 18:38, 20. Feb. 2015 (CET)

In Anbetracht der Anzahl an Artikeln zu diesen Kältemitteln sicherlich eine gute Idee -- Gruß Bert (Diskussion) 18:59, 20. Feb. 2015 (CET)
+1, -- (Diskussion) 20:21, 20. Feb. 2015 (CET)
+1, --Rjh (Diskussion) 07:24, 21. Feb. 2015 (CET)
Wären sie dann in beiden Kategorien - Kategorie:Kältemittel und Kategorie:Wärmeträger ? FIFTY SHADES … nil nisi bene 11:35, 21. Feb. 2015 (CET)
Was ist denn mit der Kategorie:Kühlmittel? Gruss, Linksfuss (Diskussion) 11:39, 21. Feb. 2015 (CET)

Vorschlag: Alle Wärmeträger, auch Kältemittel, sollen in die Kategorie:Wärmeträger eingeordnet werden, denn ein Kältemittel ist lediglich ein Wärmeträgerfluid in einer Kälteanlage. Die Kategorie:Kältemittel soll nur die R-Nummer-Weiterleitungen enthalten. --kopiersperre (Diskussion) 18:28, 21. Feb. 2015 (CET)

Klingt gut. Im Moment sind in der Kat leider nur die R-Nummern drin, keine dazugehörigen Namen. Ginge das irgendwie automatisch? Gruß, --Maxus96 (Diskussion) 20:46, 22. Feb. 2015 (CET)
Jetzt noch die Frage R-12 oder R12?--kopiersperre (Diskussion) 10:28, 23. Feb. 2015 (CET)

UN-Nummern als Weiterleitungen[Bearbeiten]

Was haltet Ihr davon, wenn die einzelnen UN-Nummern zum jeweiligen Artikel des Stoffes weiterleiten würden. (Natürlich nur da, wo das sinnvoll möglich ist.)
Beispiel: Das Lemma UN 1400 könnte auf Barium weiterleiten.
--MrAurum (Diskussion) 14:08, 23. Feb. 2015 (CET)

Halte ich genausowenig für sinnvoll wie bei CAS-Nummern (darüber gab es schon mal eine Diskussion). --Orci Disk 14:34, 23. Feb. 2015 (CET)
Viele der UN-Nummer sind Sammelnummer für giftige, brennbare, ätzende .... Stoffe, Gemische oder Zubereitungen, da macht es keinen Sinn. Für die einzelnen Stoffe gibt es in der Tabelle schon einen Link zum Lemma.
UN-Nummer Gefahrenzahl Klasse Bezeichnung
0204 1 Falllote mit Explosivstoff
0208 1 Trinitrophenylmethylnitramin (Tetryl)
-- Gruß Bert (Diskussion) 17:42, 23. Feb. 2015 (CET)
Sehe ich genauso. Mir sind da die Weiterleitungen in der Bezeichnung lieber, weil man da direkt sieht, wo der Link hingeht. Rjh (Diskussion) 20:52, 24. Feb. 2015 (CET)
Ich halte entsprechende Weiterleitungen weiterhin für sinnvoll. So leiten z. B. die einzelnen E-Nummern auch auf den jeweiligen Artikel des Stoffes weiter.
Beispiel: Das Lemma E150c leitet auf Zuckercouleur weiter.
--MrAurum (Diskussion) 17:42, 2. Mär. 2015 (CET)
Ich stimme Rjh, Bert und Orci zu, dass es wenig sinnvoll wäre, die UN-Nummern als Weiterleitungen anzulegen. Die E-Nummern sind einfach ein ganz anderes Beispiel, da z.B. auf Lebensmittelverpackungen teilweise nur die E-Nummer angegeben ist. Dann ersetzt die E-Nummer den Namen des Stoffes. In diesem Fall ist es wohl eher so, dass es ein Klassifizierungssystem gibt, das teilweise einzelne Stoffe enthält (meinetwegen auch zu einem Großteil). Es jede Menge Klassifizierungssysteme, die auch mal einzelne Stoffe in einer Gruppe enthalten, deswegen bleiben es aber Klassifizierungssysteme. Grüße, --GelberBaron (Diskussion) 12:34, 3. Mär. 2015 (CET)
Vor allem, wohin sollte die Weiterleitung zeigen wenn es ein Stoffgemisch oder ähnliches ist. Rjh (Diskussion) 13:24, 3. Mär. 2015 (CET)

Geometrie von Epoxiden[Bearbeiten]

Mir ist bei den Strukturformeln in der Chemobox von einigen Epoxiden aufgefallen, dass diese bei O–C–C einen Winkel von 180° suggerieren:

Kann/soll man das so belassen? --Leyo 21:55, 23. Feb. 2015 (CET)

Meiner Meinung nach die übliche Weise so etwas zu zeichnen. --codc Disk 00:22, 24. Feb. 2015 (CET)
Die alternative Darstellung wäre schon besser. Gruss, Linksfuss (Diskussion) 19:46, 26. Feb. 2015 (CET)
+ 1. MfG -- (Diskussion) 12:55, 27. Feb. 2015 (CET)

unlöslich[Bearbeiten]

Ich halte die Angabe von „unlöslich [in Wasser]“ in der Chemobox für zu stark vereinfachend. Fürs Arbeiten im Labor mag diese Angabe ausreichend genau sein, aber wenn sich ein Leser eher für Themen wie Trinkwasserkontaminiation interessiert, besteht eben schon ein Unterschied zwischen 0,1 g·l−1 und 0,1 μg·l−1.
Die entsprechende Suche liefert etliche Treffer. Könnte man nicht – wenn sich kein Wert angeben lässt – ein „praktisch“, „nahezu“ oder ähnlich ergänzen? --Leyo 16:21, 27. Feb. 2015 (CET)

Die Definition ist imo hier gegeben; eine Gleichsetzung von "praktisch unlöslich" und "unlöslich" halte ich für nicht so dramatisch. Gruss, Linksfuss (Diskussion)
Danke für den Link, die Tabelle habe ich jetzt 10 min gesucht (warum steht die eigentlich nicht in der Formatvorlage und der Anleitung für neue Artikel??) - ja, könnte man mM ergänzen.--Mabschaaf 16:36, 27. Feb. 2015 (CET)
+1, die Ergänzung ist eine gute Idee. Gruss, Linksfuss (Diskussion) 16:49, 27. Feb. 2015 (CET)
+1, trägt sicher zur Vereinfachung und Vereiheitlichung bei, insbesondere, wenn man die Tabelle direkt verlinkt. Aber dann stellt sich natürlich die Frage: sind die Definitionen im Europäischen Arzneibuch und das, was Chemiker darunter verstehen equivalent? Die Betrachtung der Löslichkeit von Arzneimittel zielt auf deren potentielle Wirksamkeit. Als Chemiker wird man normalerweise nicht praktisch unlöslich angeben, wenn die Löslickeit im ppm oder ppb Bereich liegt, sondern einfach nur unlöslich. Und wenn in einer Literaturstelle aus den 1930ern für eine Substanz unlöslich angegeben wird, wäre die Änderung in nahezu unlöslich doch eigentlich reine TF. -- Bert (Diskussion) 20:45, 27. Feb. 2015 (CET)
Wieso TF? Nichts ist komplett unlöslich in Wasser. Ob es Substanzen gibt, deren Wasserlöslichkeit 1 Molekül pro Liter unterschreitet, weiss ich nicht.
Weitere Alternativen wären beispielsweise „vernachläßigbare Löslichkeit in Wasser“ oder „in Wasser vernachläßigbar“. --Leyo 21:17, 27. Feb. 2015 (CET)
hmm, ich hab gerade bei den Fungiziden feststellen müssen, das einige Bücher von guter Löslichkeit bei den Substanzen sprechen und damit allerdingswert Werte meinen bei den schlecht löslich schon geprahlt ist. Es kommt eben auf die Referenz und den Blickwinkel an. Also ob die Substanzen z.B. Wochen wirksam sein müssen. Die Formulierung die die Bücher meinen ist wahrscheinlich "besser als andere ähnliche Stoffe". Also eine eindeutige Tabelle auf die wir uns beziehen wäre das beste. Ob das dann jeder gut heisst ist was anderes, aber dann ist es wenigstens eindeutig und vergleichbar. Rjh (Diskussion) 21:23, 27. Feb. 2015 (CET)
Zustimmung zu „Blickwinkel“. Bei Pflanzenschutzmitteln etwa würde ein Ökotoxikologe oder Umweltanalytiker bei einer Löslichkeit von einigen mg/l nie von „unlöslich“ sprechen. --Leyo 21:32, 27. Feb. 2015 (CET)
(BKBKBK)auch hmmmm - Ich muss Bert zustimmen: Letztlich geben wir die Aussagen von Quellen wieder. Dort steht dann i.d.R. "unlöslich" - aber bis zu welcher Löslichkeit dort evtl. "sehr schwer löslich" (o.ä.) gestanden hätte, ist nicht nachvollziehbar. Dass es aber "unlöslich" gar nicht gibt, da bin ich wieder voll bei Leyo. Mit modernsten analytischen Methoden sind praktisch immer Spuren nachweisbar. Wenn nun Zahlenwerte existieren, dann können diesen die Stichworte aus dem Arzneibuch zugeordnet werden, damit habe ich kein Problem. Wenn aber in einem Produktdatenblatt "unlöslich" steht, dann ist die Aussage "praktisch unlöslich" relativierend und gegenüber der als Referenz genannten Quelle verfälschend. Mit anderen Worten: Dann muss es eben auch bei "unlöslich" bleiben.--Mabschaaf 21:34, 27. Feb. 2015 (CET)
Uns zwingt niemand eine Quelle im Wortlaut wiederzugeben, der Sinn muss aber erhalten bleiben. Die Messung von sehr geringen Löslichkeiten ist aufwändig, so dass es nicht verwundert, dass auf Produktdatenblättern auf die einfachste Lösung („unlöslich“) zurückgegriffen wird. Demnach ist realitätsnähere Formulierung für „unlöslich“ IMHO nicht verfälschend. --Leyo 21:44, 27. Feb. 2015 (CET)
Die obige Liste von Leyo liefert 591 Einträge, darunter findet man z. B. Aluminiumhydroxid (mit Zusatzangabe 1.5 mg/l), Blei(II)oxid (17 mg/l), Cyclohexan (50 mg/l) aber auch Campher (für den GESTATIS dann 1,5 g/l angibt). Das muss sicherlich als erstes bereinigt werden. Könnte man dies mit einem bot erledigen? Für die Substanzen, die dann noch übrig bleiben könnte es Sinn machen, bei unlöslich evtl eine automatische Fußnote einfügen (... sehr geringe Löslichkeit ...). --Bert (Diskussion) 22:15, 27. Feb. 2015 (CET)
Konstante Ergänzungen oder Ersetzungen kann man problemlos automatisiert machen, Aber deine Idee für einen Botlauf sieht etwas komplexer aus. Wie stellst du dir die Bereinigung denn genau vor? --Leyo 23:24, 27. Feb. 2015 (CET)
Einträge, wie Aluminiumhydroxid, Blei(II)-oxid, Cyclohexan haben nach der Angabe unlöslich einen entsprechenden Zahlenwert. Die könnten zumindest in einer Liste zusammengefasst werden, eine automatische Ersetzung wird vermutlich aufgrund der unterschiedlichen Angaben nicht funktionieren, oder? Noch komplizierter wäre es vermutlich, wenn die Zahlenwerte aus der Referenzstelle extrahiert werden sollten, wie bei Campher. -- Bert (Diskussion) 00:14, 28. Feb. 2015 (CET)
Eigentich müsste es bei einem hohen Prozentsatz gehen, weil die Vorlage eine einheitliche Schreibweise vorschlägt. Also ...löslich in Wasser (n g/mg.l-1 bei 20 °C)<quelle> Es könnte noch ein Aufzählungspunkt davor sein, aber ansonsten müsste es so aussehen. Rjh (Diskussion) 07:21, 28. Feb. 2015 (CET)

Themenüberschneidung?[Bearbeiten]

Hallo zusammen, mir ist über's Artikelecho aufgefallen, dass heute der Artikel Dehydratisierung (Mineralogie) neu erstellt wurde. Allerdings scheint er mir eine unnötige Dopplung zum bereits bestehenden Artikel Dehydratisierung (Chemie) zu sein. Jedenfalls habe ich, falls nötig, die Minerale bisher immer an letzteren verwiesen.
Nebenbei ist der neue Artikel auch von eher schlechter Qualität und quellenlos, leider kann ich spontan aus meinen Literaturquellen aber auch nichts beisteuern (allenfalls könnte man einen Hinweis auf den Artikel Dehydratisierungsreaktion beim Mineralientlas setzen).
Hätte denn hier jemand die eine oder andere Quelle parat und könnte beide Artikel zusammenführen und ausbauen? Grüße -- Ra'ike Disk. LKU WPMin 19:47, 27. Feb. 2015 (CET)

Jep, ich sehe das auch so. Die Artikel sagen das exakt gleiche aus, verwenden allerdings andere Beispiele. Ich kann jetzt leider nicht "echte" Beispiele aufgreifen, da ich grad keine habe, aber schematisch ist es so: Chemie: 2 Fe(OH)3 \rightarrow Fe2O3 + 3 H2O; Mineralogie: Söhngeit zerfällt zu Hämatit od. Maghemit. An dieser Stelle: Keine Ahnung, ob letztgenannte Reaktion wirklich vorkommt, bei der ersten bin ich mir halbwegs sicher.
Ich habe aber leider kein Fachbuch zur Hand und kenne mich mit der Dehydration auch nicht so gut aus. Gruß --GelberBaron (Diskussion) 16:15, 2. Mär. 2015 (CET)

Leibniz-Institut für Molekulare Pharmakologie[Bearbeiten]

Hallo allerseits,

ich bin gerade über den Artikel Leibniz-Institut für Molekulare Pharmakologie gestolpert. In dem Artikel wird auf einer hohen Fachsprache über die einzelnen Forschungsgruppen und ihre Ergebnisse berichtet. Die meisten Änderungen stammen von Benutzer:FMP2013. Ich habe die Vermutung, dass hier ein Fall von Eigendarstellung vorliegt, wie auch der Benutzername nahelegt. Aber da ich als Nicht-Chemiker wenig vom Inhalt und seiner Relevanz verstehe, hoffe ich jemande von euch könnte sich das mal ansehen?

Danke und viele Grüße --Mko3 (Diskussion) 16:03, 28. Feb. 2015 (CET)

Vermutlich ist die Vermutung zutreffend. Der Artikel wurde wikifiziert, Grüße, --Ghilt (Diskussion) 17:03, 28. Feb. 2015 (CET)
Der Setzer dieses Bausteins ist der Ansicht, diese Diskussion sei erledigt. Sie wird daher nach drei Tagen automatisch in das Archiv verschoben. Bist Du der Ansicht, diese Diskussion sei noch nicht erledigt, so scheue Dich nicht, diesen Baustein durch Deinen Diskussionsbeitrag zu ersetzen! --Ghilt (Diskussion) 17:03, 28. Feb. 2015 (CET) Erledigte Diskussion