Wikipedia:Auskunft/Archiv/2014/Woche 07

aus Wikipedia, der freien Enzyklopädie
Wechseln zu: Navigation, Suche
Dies ist ein Archiv der Seite Wikipedia:Auskunft. Es enthält alle Abschnitte, die in der Kalender-Woche 07 im Jahr 2014 begonnen wurden.

Verwende für eine aktuelle Auskunfts-Frage bitte nur die aktuelle Seite und setze in deine Frage ggf. einen Verweis auf den Diskussions-Abschnitt, den du wieder aufgreifen möchtest. So wird’s gemacht: [[Wikipedia:Auskunft/Archiv/2014/Woche 07#Abschnittsüberschrift]]

← vorherige Woche Filing cabinet icon.svg
Gesamt­archiv
nächste Woche →

Inhaltsverzeichnis

Kaufkraft

Welcher Kaufkraft entsprachen 30.000 (Vereins-?)Taler im Jahr 1868/69? Eine ungefähre Vorstellung würde mir genügen. Schöne Grüße  TRN 3.svg • hugarheimur RIP Klara Winter 07:37, 11. Feb. 2014 (CET)

So ganz seriös lässt sich das natürlich nicht beantworten, da es kaum einen vergleichbaren Warenkorb gibt. Das gesagt, nimm grob den Faktor 20 bis 25 für eine Hausnummer in Euro. Viele Gebrauchsgüter waren eher billig, auch Immobilien, da müsste man also einen höheren Faktor ansetzen. Reisen war vergleichsweise teuer; eine Passage nach Amerika kostete damals, wenn ich mich richtig erinnere, etwa 60 Taler, für einen einfachen Arbeiter ein halbes Jahreseinkommen. Der aktuelle Silberwert eines Talers beträgt so ca. 7 Euro. Oh, hier eine Tabelle mit Beispielen. Grüße Dumbox (Diskussion) 08:26, 11. Feb. 2014 (CET)
Danke dir. Grüße  TRN 3.svg • hugarheimur RIP Klara Winter 16:03, 11. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von:  TRN 3.svg • hugarheimur RIP Klara Winter 16:03, 11. Feb. 2014 (CET)

Was ist ein ... Qualitätsmedium ?

Ich stosse im Web (auch bei WP) auf diesen Begriff, finde aber keine Definition. Gibt es messbare Kriterien - so wie bei Massenmedium - um ein Medium (Zeitschrift, Sendung, Blog etc.) als "Qualitätsmedium" einzuordnen ? GEEZER… nil nisi bene 09:53, 11. Feb. 2014 (CET)

Ausgenommen von den Qualitätsmedien sind die Bonner Systemmedien.--11:17, 11. Feb. 2014 (CET) (ohne Benutzername signierter Beitrag von 84.162.230.126 (Diskussion))

Wenn, dann heute die Berliner Systemmedien... --Eu-151 (Diskussion) 13:05, 11. Feb. 2014 (CET)

Kann man aus den Antworten ableiten, dass ihr ebenso ein Problem mit einer Definition habt...? GEEZER… nil nisi bene 13:17, 11. Feb. 2014 (CET)
Ja. Noch vor ein paar Jahren hätte ich dir ohne Zögern eine Liste von Medien und einige Auswahlkriterien aufgezählt, aber mittlerweile verbreiten zB auch die SZ und die FAZ zuviel offensichtlichen Schrott bzw tendenziöses Zeug. Oder es wird heute nur deutlicher. Beispiel: Als Obama Ende letzten Jahres zum Krieg gegen Syrien blies, wies die SZ ihre Leser nicht etwa pflichtbewusst darauf hin, dass der Gaseinsatz durch Assad völlig unbewiesen war, sondern rührte mächtig die Kriegstrommel. Das stieß den Lesern derart sauer auf, dass die SZ ihren diesbezüglichen Chef-Kommantator unter dem Proteststurm schließlich auswechseln musste. Solaris3 (Diskussion) 15:26, 11. Feb. 2014 (CET)
Grauer: Qualitätsautormedium? Alles Selbstbezichtigung. --Dansker 15:35, 11. Feb. 2014 (CET)
(en passant:) Qualitätsmedien gehören zur Gruppe der relativen Phänomene. --Aalfons (Diskussion) 15:46, 11. Feb. 2014 (CET)
Der Abschnitt erforderte meine volle Aufmerksamkeit - und ein bissl klarer sehe ich jetzt. Danke. GEEZER… nil nisi bene 16:02, 11. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: GEEZER… nil nisi bene 16:02, 11. Feb. 2014 (CET)
Ist sowas ähnliches wie Premiummedium. --Chricho ¹ ² ³ 23:34, 11. Feb. 2014 (CET)

Gewichtsschwankungen

Wie gross sind die Schwankungen des Körpergewichts maximal in 24 h? Wenn ich also normalerweise 100 kg wiegen würde, um wie viel kann ich das Gewicht mit überfressen hochtreiben oder gar nichts essen/trinken und damit absenken? Gibt es da empirische Werte? Yotwen (Diskussion) 14:57, 11. Feb. 2014 (CET)

Du kannst die Frage einfach reduzieren auf: (a) Wieviel Wasser kann man trinken, ehe man einknickt und (b) Wieviel Wasser kann man verlieren, ehe nan einknickt.
Bei (a) gibt es einen Erfahrungswert von 6 Liter Wasser in 3 Stunden - aber die Dame hat diesen kalifornischen Wettbewerb nicht überlebt. Also Extremwert: Wohl knapp unter 10 % des Körpergewichtes. GEEZER… nil nisi bene 15:19, 11. Feb. 2014 (CET)
Normalwerte etwa bei 1,5-2,5 %, je nach Lebenswandel, bei Sportlern auch schon mal das Doppelte (Gewichtsverlust...). GEEZER… nil nisi bene 15:37, 11. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: Reicht mir als Antwort. Ist viel mehr, als ich erwartet hätte. Yotwen (Diskussion) 15:30, 11. Feb. 2014 (CET)

Variabelstruktur (erl.)

Ich soll für meinen Chef die Variabelstruktur für bestimmte Variablen eines Datensatzes (Einkommens- und Verbrauchsstichprobe 2008) untersuchen und ihm sagen, wie die aufgebaut/konzeptualisiert sind. Wie mach ich das am besten? -- Alt 11:14, 12. Feb. 2014 (CET)

Was soll man da antworten? Mir fällt als Tipp nur folgendes ein: Proseminar Statistik 1 und 2 auf der nächsten Uni besuchen. --El bes (Diskussion) 12:11, 12. Feb. 2014 (CET)
Dazu isses wahrscheinlich schon ein wenig spät. Ich kann durchaus ein wenig mit Stata usw. umgehen, nur kann ich schlicht mit dem Begriff Variabelstruktur anfangen.-- Alt 12:39, 12. Feb. 2014 (CET)
Der Chef meint das vielleicht ganz simpel, so wie Einkommensverteilung, etc. Kauft ein Kunde 50 Produkte und 50 andere Kunden kaufen nur eines? Wie steht das in Relation zum Durchschnittskauf pro Kunde, etc. --El bes (Diskussion) 12:42, 12. Feb. 2014 (CET)
Kann es sein, dass es um den Aufbau einer Datenbankstruktur geht? Ansonsten... geh zu einem Kollegen oder dem Chef und frag. --Eike (Diskussion) 12:44, 12. Feb. 2014 (CET)
Hab letzteres gemacht (geht um eine Gegenüberstellung verschiedener Variablen mit Blick auf ihren Aufbau), danke :) -- Alt 13:37, 12. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: Yoursmile (Diskussion) 13:41, 12. Feb. 2014 (CET)

Bankkonto als Pflicht?

Ist ein Arbeitgeber gesetztlich dazu verpflichtet, den Arbeitnehmer das Geld direkt auf sein Konto zu überweisen? Oder wäre ein Gehaltscheck oder eine "Lohntüte" auch zulässig? (nicht signierter Beitrag von 188.101.91.131 (Diskussion) 11:12, 10. Feb. 2014 (CET))

Nein. Ja. Hiernach kann er dir sogar die Vergütung in Sachmitteln (Kaninchen, Holzlatten, Streusalz etc.) auszahlen - soweit es vereinbart war. GEEZER… nil nisi bene 11:20, 10. Feb. 2014 (CET)
Eine gesetzliche Verpflichtung zur unbaren Zahlung von Arbeitsentgelt (das wäre gleichbedeutend mit dem Verbot der Entlohnung in bar) gibt es in Deutschland bislang nicht. --Snevern 11:22, 10. Feb. 2014 (CET)
Das mag so sein, das Problem geht wohl aber dann los, wenn man Sozialleistungen empfängt.--scif (Diskussion) 11:41, 10. Feb. 2014 (CET)
Es war zwar nicht danach gefragt, aber die Probleme können schon viel früher losgehen, zum Beispiel beim Abschluss eines Mietvertrages. Vieles geht heutzutage nur noch mit Bankkonto. Es ging aber dem Fragesteller nicht darum, ob der Arbeitgeber unbar leisten darf (und sich womöglich weigert, bar zu zahlen), sondern ob er gesetzlich sogar dazu verpflichtet ist. Und das ist klar zu verneinen. --Snevern 12:08, 10. Feb. 2014 (CET)
Grundsätzlich richtig, aber wenn ich die Überschrift als Frage sehe, kommt meine Antwort wieder hin. Es stellt sich ja zwangsläufig nach einer evtl. Weigerung des Arbeitgebers die Frage, ob ein Bankkonto Pflicht ist. Und da haben wir wieder den Unterschied zwischen Theorie und Praxis, getreu nach Radio Jerewan: Im Prinzip nein, aber... Mir war aber so, das Banken sich nicht mehr weigern dürfen, ein Bankonto anzulegen. Das war ja früher das Problem, das es Personengruppen gab, die, selbst wenn sie wollten, kein Konto mehr bekamen, und damit von den Ämtern keine Leistung ausgezahlt bekamen. Um das Thema mal rund zu machen. Also, der Bürger muß kein Konto haben, es liegt aber heute fernab der Lebenswirklichkeit, diesen Aufstand proben zu wollen.--scif (Diskussion) 14:05, 10. Feb. 2014 (CET)
Ich habe mein Konto nur noch für's Gehalt. Die Miete zahl ich meiner Vermieterin bar am Monatsanfang miz Quittung, die Frau wohnt über mir. Für Strom & Gas hat es einen Kassenautomaten bei meinen Stadtwerken und selbst Internet- und Handyrechnungen zahle ich bar im O2-Laden ein, so dass niemals etwas vom Konto abgezogen wird. Für alles andere gibt es Bargeld. Und sollte es halt mal trotzdem nicht reichen und ich muss was im Netz bestellen, dann sorge ich vorab dafür, dass der Betrag auf dem Konto ist, 100 Euro lass ich eh immmer stehen. Und wozu Aufstand proben? Nachdem es mittlerweile P-Konten gibt? --46.244.137.9 14:13, 10. Feb. 2014 (CET)
Ach ja, die Überweisung für die Zwangsgebühren der GEZ habe ich völlig verdrängt... --46.244.137.9 14:27, 10. Feb. 2014 (CET)
Ich verstehe die Frage so, ob der Arbeitgeber gesetzlich verpflichtet ist, den Arbeitslohn unbar auszuzahlen. Dies kann z.B. eine Rolle spielen, wenn eine Kontopfändung, aber keine Lohnpfändung vorliegt, der Arbeitnehmer den Arbeitslohn deshalb vom Arbeitgeber als Barauszahlung verlangt und der Arbeitgeber sich weigert mit der Begründung, er sei zur unbaren Zahlung verpflichtet. (Die rechtliche Würdigung des Umgangs mit der Kontopfändung und die Pfändungsfreigrenzen spielen bei der Frage hier erstmal keine Rolle.) Wie bereits oben ausgeführt gibt es keine gesetzliche Verpflichtung und es kommt darauf an, was zwischen Arbeitgeber und Arbeitnehmer vertraglich vereinbart ist. Weil durch eine Barauszahlung in den meisten Fällen Kosten entstehen, werden viele Arbeitgeber, wenn sie keinen Vorteil für sich erkennen, lieber nach einem Weg und einer Begründung suchen, diesen Zahlungsweg zu vermeiden. Es gibt zwar keine gesetzliche Verpflichtung, aber der Arbeitgeber könnte (wenn die Voraussetzungen dafür gegeben sind) versuchen sich auf seine Verpflichtungen zu beziehen, die aus dem Manteltarifvertrag resultieren. Ein Beispiel hierfür wäre der § 13.1 des MTV BZA DGB, der regelt: "Die Mitarbeiter erhalten ein Monatsentgelt auf Basis ihrer vereinbarten individuellen regelmäßigen Arbeitszeit, das spätestens bis zum 15. Banktag des Folgemonats in der Regel unbar ausgezahlt wird." Die Formulierung "in der Regel" läßt zwar eine abweichende vertragliche Regelung zu, der Arbeitgeber muß sich aber nicht darauf einlassen, wenn der bestehende Arbeitsvertrag bereits etwas anderes regelt bzw. auf einem entsprechenden Manteltarifvertrag basiert. --84.191.132.1 17:01, 10. Feb. 2014 (CET)

Frage zu Telekom will Festnetzanschlüsse auf IP umstellen

Hallo zusammen, hatte eben einen freundlichen Anruf der Telekom, die mir angeboten haben, meinen bestehenden DSL mit ISDN Anschluss auf IP-Telefonie mit Fernsehen umzustellen. Ich habe daraufhin das Angebot freundlich abgelehnt, da ich aktuell in meinem Ort nur über maximal 2MBit verfüge und Fernsehen kommt über die Schüssel rein. Er meinte dann, das würde er sehen, dass es aktuell 2 MBit sind und es würde dann auf 6MBit bei Vertragswechsel umgestellt werden. Daraufhin entgegnete ich ihm, dass mir dass dann aber zu wenig sein wird, da unser Stromenergieversorger im letzten Jahr angefangen hat, Glasfaserkabel zu verlegen und in den Vorabprospekten wird von 25 und 50 Mbit geschrieben. Von daher habe ich das Angebot nochmals abgelehnt, da ich ja dann ansonsten mich wieder 2 Jahre an die gute alte Telekom binde. So weit zum Hintergrund, jetzt meine Frage: Hat jemand IP-Telefonie mit maximal 6 Mbit? Würde das überhaupt Sinn machen? Danke und Gruß kandschwar (Diskussion) 17:03, 10. Feb. 2014 (CET)

IP-Telefonie funktioniert schon mit deutlich weniger, ich hatte es mal mit 2 MBit/s, und es funktionierte perfekt, obwohl das schon fast 10 Jahre her ist. Solaris3 (Diskussion) 17:06, 10. Feb. 2014 (CET)
Für die Telefonie ist das recht egal wie schnell. Zum Fernsehen sind 6 Mbit sehr wenig. Ich hätte erstmal gefragt, ob du hardware bekommst um deine ISDN-Telefone weiter zu betreiben.--Trockennasenaffe (Diskussion) 17:09, 10. Feb. 2014 (CET)
ADSL-Annex-Übersicht
Annex-J-Spektrum
Ich habe einen Annex-J-Anschluss mit nominell 16 Mb/s und tatsächlich 14 Mb/s downstream und satten 2,5 Mb/s upstream. Wenn die 2,5 upstream ausreichen, dann reichen auch 6 Mb/s downstream zum telefonieren. Fürs IP-Fernsehen sind 6 Mb/s IMHO nicht ausreichend. Der Vorteil von Annex J mit IP-Telefonie gegenüber POTS (analog, „Standard“ in DTAG-Diktion) oder ISDN („Universal“ in DTAG-Diktion) ist, dass der Frequenzbereich, der vorher für POTS oder ISDN genutzt wurde, dauerhaft für Internet und IP-Telefonie zur Verfügung steht. Die DTAG hat von Anfang an auf Annex A verzichtet und auch bei POTS-Anschlüssen nur ADSL Annex B angeboten, sodass bei Umstieg von analog auf Annex J auch der bisher ungenutzte Frequenzbereich genutzt werden kann. Ein IP-basierter Anschluss ist etwas günstiger als ein ISDN-Anschluss, dafür braucht man einen Annex-J-fähigen Router, der mich damals über 200 Euro gekostet hat. Ich konnte mein ISDN-Telefon weiternutzen. Nach ca. vier Jahren hat man die Ausgabe für den Router wieder drin und surft und telefoniert dann günstiger. --Rôtkæppchen68 18:02, 10. Feb. 2014 (CET)

Hallo zusammen, vielen Dank schon mal für die Antworten. Das es für das Telefonieren langt habe ich mir ja schon fast irgendwie gedacht. Aber das mit dem Fernsehen verstehe ich nicht, da kann ich mir einfach nicht vorstellen wie das funktionieren soll. Zumal mindestens zwei Fernsehgeräte vorhanden sind und auch beide laufen. Kommt dann das Signal aus der "Telefondose" oder weiterhin vom Satelliten? Den Vorteil für mich habe ich da jetzt noch nicht entdeckt. Klar, die Telekom kann dadurch Kosten sparen und mich weiterhin für mindestens zwei Jahre binden. Gruß kandschwar (Diskussion) 19:33, 10. Feb. 2014 (CET)

Ah jetzt ja: Telekom Deutschland bietet ja nicht nur rein IP-TV-basiertes Fernsehen an, sondern auch die Kombination von IP und Satellitenfernsehen, genannt Telekom Entertain Sat, wo der Fernsehcontent über Satellit gesendet wird. Das Programmangebot umfasst dabei die freiempfangbaren Astra-Sender, das HD+-Paket und ein paar Bezahlsender. Wenn Du zwei Fernseher betreiben willst, muss einer auf Bezahlfernsehen verzichten, also normales freiempfangbares Satellitenfernsehen nutzen. Oder Du brtauchst einen zweiten Telekom-Receiver. Wenn Du aber auf das unfreie Angebot von Telekom Entertain komplett verzichten kannst, bringt Dir Telekom-Fernsehen nichts gegenüber freiem Satellitenfernsehen. Ich habe mein IP-basiertes Telekom-Fernsehen zur Mindestlaufzeit des Vertrages gekündigt. Telekom Entertain war enttäuschend. Ich empfehle es niemandem weiter. --Rôtkæppchen68 19:47, 10. Feb. 2014 (CET)
Für Telefonie reicht viel weniger als 2 MBit/s, selbst für Videotelefonie in ordentlicher Qualität. IP-Telefonie braucht allerdings lokale Hardware mit lokalem Strom zum kodieren bzw. komprimieren. Der Netzbetreiber spart dabei gleich doppelt Netzkapazität und Strom. Außerdem funktioniert ISDN selbst bei lokalem Stromausfall, ein Voice over IP-Anschluss dann aber nicht mehr, was wegen dem häufigen Zusammenhang mit Notfällen ein erstes Problem dieser Technik ist. Sagen die dir natürlich nicht. Dafür hat man das Kleingedruckte erfunden. Die wollen also doppelt und dreifach sparen - auf deine Kosten und ohne das du es sofort mitbekommst. --Kharon 19:48, 10. Feb. 2014 (CET)
(Nur) falls du ein TV-Fan bist, bietet dir TV über IP allerdings einiges an Vorteilen. Zeitversetztes Gucken, Filme aus einer Datenbank sehen, etc. Ich würd mal deren Broschüre/Webauftritt studieren. An das Senderangebot über Satellit wird das aber nicht rankommen, allerdings kannst du deinen Satellitenempfang auch wie bisher parallel weiternutzen, der kostet ja in der Regel nichts. Solaris3 (Diskussion) 20:07, 10. Feb. 2014 (CET)
@Kharon, das Problem an IP-Telefonie über zu schmalbandige Verbindungen ist eher der Jitter, also die Abweichungen der Laufzeit der einzelnen Pakete. Bei G.711 über ISDN reichen 64 kb/s. Nutzt Du aber IP-Telefonie mit G.711-Codierung, so sind es laut Artikel schon 80 bis 128 kb/s. Da der Telekom-IP-Anschluss aber ISDN ersetzt, sind 256 kb/s Upstream absolutes Minimum, besser mehr. Die Alternative wäre ein besser komprimierender Codec wie G.726, G.728 oder G.729. Bessere Kompression heißt hier aber schlechtere Verständlichkeit. --Rôtkæppchen68 21:20, 10. Feb. 2014 (CET)

NSM?

Was bedeutet die Abkürzung in diesem Artikel: Kulturindustrie_–_Aufklärung_als_Massenbetrug#Wechselwirkung_zwischen_Subjekt_und_Massenkonsumg.C3.BCtern

Redaktionelles Kürzel vlt.--93.133.113.239 21:38, 10. Feb. 2014 (CET)

Es dürften wohl Neue Soziale Bewegungen (new social movements = NSM) gemeint sein, bzw. die Theorie darüber. Mit dem Begriff fasste man damals die neu entstandenen Bürgerrechtsbewegungen, Friedensbewegung, Ökologiebewegung, alternative Gruppen, etc. zusammen, das was man heute Zivilgesellschaft nennt. Auf den Konnex bin ich gekommen durch diese Fundstelle: Harry F. Dahms: Nature, Knowledge and Negation, Seite 274, vorletzter Absatz. --El bes (Diskussion) 22:57, 10. Feb. 2014 (CET)

Todesurkunde

Lese ich das richtig, dass sie um 20 Uhr starb? --Jack User (Diskussion) 16:36, 12. Feb. 2014 (CET)

Ich lese da (ungefähr viertletzte Textzeile von unten): "NachVormittags um acht Uhr". --88.130.82.19 16:43, 12. Feb. 2014 (CET)
Ehrlich? Ich lese da so was von deutlich "Vormittags" (in Sütterlinschrift, versteht sich). Hm. Grüße Dumbox (Diskussion) 16:47, 12. Feb. 2014 (CET)
Da muss _Vor_mittag stehen; das erste Zeichen ist ein "V" und dann vergleich doch mal das "ach" von "acht Uhr" mit den entsprechenden Zeichen des vermeintlichen "N_ach_mittag". Wie man auf die Idee kommen kann, da stünde Nachmittag...echt abwegig... *pfeif* --88.130.82.19 16:56, 12. Feb. 2014 (CET)
Nächstes Mal: Router aus, Router an. ;o) Dumbox (Diskussion) 17:06, 12. Feb. 2014 (CET)
Nö, ich steh dazu. --88.130.82.19 17:17, 12. Feb. 2014 (CET)
Vormittags. --178.195.134.244 16:53, 12. Feb. 2014 (CET)
+8 --Rôtkæppchen68 16:58, 12. Feb. 2014 (CET)
Handschriftliches Sütterlin ist Mist, kein Wunder, dass es ausgestorben ist, gedrucktes kann ich lesen. :) Für mich sah es aus wie ein N und danach wie ein ach(?) --Jack User (Diskussion) 17:12, 12. Feb. 2014 (CET)
Es ist Deutsche Kurrentschrift. Ludwig Sütterlin (Grafiker) hat seine Variante der Kurrentschrift erst 1911 entwickelt. --Rôtkæppchen68 17:19, 12. Feb. 2014 (CET)
Sütterlin hat übrigens auch ein lateinisches Alphabet entwickelt. Die Bezeichnung Sütterlinschrift für die deutsche Kurrentschrift ist also mehr als unglücklich. --Hermine Tuzzi (Diskussion) 17:24, 12. Feb. 2014 (CET)
Oh, wir haben sogar einen Artikel: Sütterlinschrift. Die Wikipedia ist ihrer Vollendung nahe. --Hermine Tuzzi (Diskussion) 17:30, 12. Feb. 2014 (CET)
„des Jahres tausend acht hundert siebenzig und sechs“ – das würde dem Verein Zwanzigeins gefallen! --Hermine Tuzzi (Diskussion) 17:16, 12. Feb. 2014 (CET)
Macht es als präsütterlin nicht lesbarer.. :) --Jack User (Diskussion) 17:27, 12. Feb. 2014 (CET)
Aber vor allem gebührt mein Dank dem Standesamt Tegernsee - ohne viel Federlesen einfach mal gescannt und per Mail geschickt - kostenfrei. Gefällt mir, gefällt mir sehr gut. --Jack User (Diskussion) 17:28, 12. Feb. 2014 (CET)

Zwanzig-Zehn wäre dann bei denen Dreißig? :D --Jack User (Diskussion) 18:33, 12. Feb. 2014 (CET)

Na ja, soll die Sterbeurkunde nicht in den Artikel, er benennt ja viel, u.a. auch, dass die Familie dem Ritterstande angehörte (eine Klasse über dem "nur Von-Adel".--G-Michel-Hürth (Diskussion) 19:07, 12. Feb. 2014 (CET)

„Tegernsee am 14.ten April 1876.
Vor dem unterzeichneten Standesbeamten erschien heute, der Persönlichkeit nach bekannt der Kgl. Bezirksarzt Dr. Alois Rosner, wohnhaft in Tegernsee, Haus Nr. 25a und zeigte an, daß Amalie von Stubenrauch, kgl. würtembergische Hofschauspielerin, 72 Jahre 6 Monate alt, katholischer Religion, wohnhaft in Tegernsee, Haus Nr. 108, geboren zu München, Tochter des verstorbenen kgl. Revisors Johann von Stubenrauch und dessen verstorbenen Ehefrau Walburga geborene Mossmayr zu Tegernsee am vierzehnten April des Jahres tausend acht hundert siebenzig und sechs Vormittags acht Uhr verstorben sei.
Randvermerk: Die Familie Stubenrauch gehört nicht der V. Adelsklasse, sondern der Ritterklasse an. Am 19. Juli 1877. Kgl. Amtsgericht Tegernsee.“ Hoffe das half noch weiter. --HOP 19:25, 12. Feb. 2014 (CET)

Danke nochmals, den Text übernehme ich so für die Diskseite des Artikels. --Jack User (Diskussion) 20:30, 12. Feb. 2014 (CET)

Das abgekürzte „verst.“ musss grammatisch richtig zu „dessen verstorbener Ehefrau“ werden. --Jossi (Diskussion) 11:05, 13. Feb. 2014 (CET)
Und die kgl. würtembergische pensionierte Hofschauspielerin noch ergänzen, dann paßt's. --Hermine Tuzzi (Diskussion) 11:22, 13. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: Jack User (Diskussion) 10:11, 13. Feb. 2014 (CET)

Duden: Stilikone (auch Stil-Ikone)

Ich bin auf der Suche nach dem ersten Dudeneintrag von Stilikone. Der Begriff kam (nach Analyse einiger Zeitungen) um die Jahrtausendwende so richtig ins Rollen. Ich vermute also: allerallerfrühestens 1995, aber wahrscheinlich erst so um 2005 im Duden (oder später). Kann das bitte jemand in seinem Duden (mit Ref.) nachprüfen? Und dann auch noch Modeikone? (Also: (a) Ikone (vielleicht dort), dann (b) Stilikone und auch (c) Modeikone). Das WP-Schreibpersonal dankt! GEEZER… nil nisi bene 17:18, 12. Feb. 2014 (CET)

Nicht ganz der Zeitraum, nachdem du gefragt hast, aber mein Duden von 1961 kennt jedenfalls noch keine Stilikone. ;) --ireas (Diskussion) 17:24, 12. Feb. 2014 (CET)
Wörterbuch Ikone? Stilikone? Modeikone? nachgeschlagen von
51897 ✘ Nein ✘ Nein ✘ Nein --Hermine Tuzzi (Diskussion) 17:52, 12. Feb. 2014 (CET)
81905 ✘ Nein ✘ Nein ✘ Nein --Hermine Tuzzi (Diskussion) 17:52, 12. Feb. 2014 (CET)
91923 ✔ Ja (Ikon) ✘ Nein ✘ Nein --Hermine Tuzzi (Diskussion) 17:52, 12. Feb. 2014 (CET)
Der große Duden 101930 ✔ Ja (Ikon + Ikone = Statue) ✘ Nein ✘ Nein --Hermine Tuzzi (Diskussion) 17:52, 12. Feb. 2014 (CET)
Der große Duden 101933 (3. Neudruck) ✔ Ja (Ikon + Ikone = Statue) ✘ Nein ✘ Nein --G-Michel-Hürth (Diskussion) 18:29, 12. Feb. 2014 (CET)
Der große Duden, 1961 ✔ Ja ✘ Nein ✘ Nein --ireas (Diskussion) 17:24, 12. Feb. 2014 (CET)
Der große Duden 151964 ✔ Ja ✘ Nein ✘ Nein --Hermine Tuzzi (Diskussion) 17:52, 12. Feb. 2014 (CET)
21. Duden von 1996 ✔ Ja ✘ Nein ✘ Nein --MannMaus 17:33, 12. Feb. 2014 (CET)
22. von 2000 ✔ Ja ✘ Nein ✘ Nein --Benutzer:Duckundwech 23:56, 12. Feb. 2014 (CET)
23. von 2004 ✔ Ja ✔ Ja ✘ Nein --Hermine Tuzzi (Diskussion) 17:43, 12. Feb. 2014 (CET)
24. von 2006 ✔ Ja ✔ Ja ✘ Nein --MannMaus 17:33, 12. Feb. 2014 (CET)
25. von 2009 ✔ Ja ✔ Ja ✘ Nein --Iduna (Diskussion) 19:14, 12. Feb. 2014 (CET)
26. von 2013 ✔ Ja (Ikon, das [!] + Ikone) ✔ Ja ✘ Nein --Hermine Tuzzi (Diskussion) 19:58, 12. Feb. 2014 (CET)
Klasse! Wir pirschen uns heran... GEEZER… nil nisi bene 17:38, 12. Feb. 2014 (CET)
Modeikone scheint nicht mal im aktuellen Duden zu stehen. --Komischn (Diskussion) 17:39, 12. Feb. 2014 (CET)
Aber Stilikone --Jack User (Diskussion) 17:42, 12. Feb. 2014 (CET)

Ich bin mir sicher: keinesfalls vor http://en.wikipedia.org/wiki/Biker_Like_an_Icon, --Vsop (Diskussion) 17:46, 12. Feb. 2014 (CET)

Wird verfolgt werden. Style icon und fashion icon taucht im Englischen früher auf als im Deutschen. GEEZER… nil nisi bene 07:55, 13. Feb. 2014 (CET)
Methodische Anmerkung: Möglicherweise koinzidiert das Auftauchen von Stilikone im Duden bloß mit dessen Gebaren, seit einiger Zeit wie blöde alle möglichen Zusammensetzungen in das Verzeichnis aufzunehmen, um Masse zu generieren (25.000 neue Schlagwörter! Jetzt weibliche Form zu jeder Berufsbezeichnung!!!!!!11 Leute, kauft den Duden, sonst wißt ihr nicht, wie man Schneiderin schreibt!! [[1], [2], [3], [4] [5]]), obwohl das bei einem Rechtschreibwörterbuch völlig sinnlos ist, weil die Zusammensetzung natürlich nicht anders geschrieben wird als ihre Komponenten einzeln. --Hermine Tuzzi (Diskussion) 18:05, 12. Feb. 2014 (CET)
Fehlende männliche Formen für Hure (Hurer ist etwas anderes), Dirne und ... wie wäre es mit Nutello ? GEEZER… nil nisi bene 07:55, 13. Feb. 2014 (CET)
Und meine Mutter war meine Ikone beim Stillen. Eine Stillikone, sozusagen. Ich hätte mich nie an die Brust einer anderen getraut (jedenfalls nicht zu Stillzwecken und in dem Alter) :D --Jack User (Diskussion) 18:40, 12. Feb. 2014 (CET)
Eigentlich war sie ja dann deine Ikonin - du solltest denen mal schreiben, dass das Wort noch fehlt. ;-) --88.130.82.19 19:46, 12. Feb. 2014 (CET)
Dass ihr grossartig seid, wisst ihr ja, oder? :-))
Die Spannung steigt - meine weibliche Seite sagt: "Nein, <seufz> 2000 noch nicht." Aber hat sie recht damit...? (Das Ganze soll eine Miniatur werden, die auch den engl. Begriff umfasst....) GEEZER… nil nisi bene 19:45, 12. Feb. 2014 (CET)
deine weibliche seite hat recht. (<seufz>) --62.227.180.215 20:13, 12. Feb. 2014 (CET)
In den DDR-Duden von 1969 und 1984 [und 1985 auch nicht --Tommes  23:06, 12. Feb. 2014 (CET)] taucht auch nur jeweils Ikone auf. Bei Durchsicht der Archive von FAZ, Spiegel und Zeit taucht das Wort (Stil-Ikone) 2001 auf, dazu gibt es noch einen Spiegel-Online-Artikel von 1999. Die Zeit beschreibt 1998 z. B. eine Polit-Ikone, Stil-Ikone aber auch erst seit 2001.
@Hermine Da Du Dich ja auf dem Felde auskennst - gab es im alten Rom überhaupt Gladiatorinnen oder ist das einfach so eine Analogiebildung? (Im DUW von 2006, das ebenfalls schon eine Menge femininer Formen erfaßt, fehlt der Eintrag.)--IP-Los (Diskussion) 19:52, 12. Feb. 2014 (CET)
Das ist wohl eine reine Analogiebildung -- darum ist es ja auch so lächerlich. Die (extrem seltenen) weiblichen Gladiatoren hießen wenn, dann Gladiatrizen; gehört aber wohl eher in den Fremdwörterduden, wenn überhaupt. Müßte es, wenn es Vorständin heißt, nicht auch eigentlich Gladiatörin heißen? SCNR --Hermine Tuzzi (Diskussion) 20:02, 12. Feb. 2014 (CET) PS: Das Wort gladiatrix kommt in der gesamten überlieferten lateinischen Literatur nicht vor, nur in einem Scholion zu der Juvenalstelle, die im englischen Artikel geboten wird (6,251).
Wörterbuch Ikone? Stilikone? Modeikone? nachgeschlagen von
Wiktionary 2012 ✔ Ja ✔ Ja ✔ Ja --Yoursmile (Diskussion) 20:47, 12. Feb. 2014 (CET)
Glädiatorin hätte aber auch etwas. Wenigstens wurde es nicht die Gladiatora. Auf diesen einen Beleg ein "Moritura te salutat."--IP-Los (Diskussion) 21:52, 12. Feb. 2014 (CET)
"Nec moritura tenet crudeli funere Dido?" - Ah, Vergil! Zu fashion icon habe ich dieses Snippet von 1989. Grüße Dumbox (Diskussion) 22:21, 12. Feb. 2014 (CET)
Ave Caesar (m/f), moriturAi te salutant. --Hermine Tuzzi (Diskussion) 11:32, 13. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: Der offizielle Empfang ist erledigt, aber Assoziationen sind noch erlaubt. Mit Dank GEEZER… nil nisi bene 07:55, 13. Feb. 2014 (CET)

DNS-Zone anpassen

Wie habe ich die DNS-Zoneneinstellungen anzupassen, damit eine nur für E-Mail genutzte Domain (MX-Record sowie ein CNAME für mail.xyz.ch auf einen grossen Mailhoster) auf einen http-Aufruf auf xyz.ch bzw. www.xyz.ch der Browser "The domain name does not exist." retourniert? Im Moment wird bei Aufruf ein Template des Hosters gezeigt, dass da noch keine Website aktiv wäre, was mich stört. Werde selbst nach Googeln nicht so richtig schlau. --Filzstift  12:00, 13. Feb. 2014 (CET)

Da die Anfrage beim DNS-Server nicht vom Client (Mail-Client oder Webbrowser) gestellt wird sondern vom zugrundeliegenden TCP/IP-Stack (bzw. dem des Proxyservers dazwischen), kann der DNS-Server nicht wissen, ob er bei derselben Frage etwas gutes oder etwas schlechtes antworten soll. Mein Tip: Wenn Du die „Hier noch keine Seite“-Meldung loswerden willst, erstelle dort einfach eine mit minimalstem Inhalt (zum Beispiel gar nichts oder eine Weiterleitung). —[ˈjøːˌmaˑ] 12:14, 13. Feb. 2014 (CET)
... oder einen Mailto:-Link. (Ja, ich glaube, dass man Mailadressen auch im Web nutzen sollte.) --Eike (Diskussion) 12:23, 13. Feb. 2014 (CET)
Mailto:-Links sind Spammagneten. Besser seinlassen. --Rôtkæppchen68 12:45, 13. Feb. 2014 (CET)
Das hatten wir schonmal. Die Lösung war glaubich, dem DNS alle anderen als den MX-Record zu löschen. Muss mal im Archiv suchen… --Rôtkæppchen68 12:41, 13. Feb. 2014 (CET)
Siehe Wikipedia:Auskunft/Archiv/2013/Woche 48#Domain nur für E-Mail nutzen und Wikipedia:Auskunft/Archiv/2011/Woche 45#.de-Domain nur für E-Mails nutzen. --Rôtkæppchen68 12:44, 13. Feb. 2014 (CET)
Führt Geezer noch sein FAQ-Archiv? —[ˈjøːˌmaˑ] 12:54, 13. Feb. 2014 (CET)
FAQ me, FAQ you, FAQ everybody - da kann jeder reinschreiben. Auch noch "Lichtgeschwindigkeit"- oder "Universum"-Fragen... GEEZER… nil nisi bene 14:07, 13. Feb. 2014 (CET)
Hab’s hinzugefügt.[6] --Rôtkæppchen68 00:20, 14. Feb. 2014 (CET)

Danke euch allen, WP:AU übertrifft tatsächlich die allwissende Müllhalde. --Filzstift  17:22, 13. Feb. 2014 (CET)

Archivierung dieses Abschnittes wurde gewünscht von: Filzstift  17:22, 13. Feb. 2014 (CET)

Photon  =  E R R O R  ?! Seite defekt?

[skT] --217.84.69.72 01:08, 14. Feb. 2014 (CET)

Nein, da funktioniert alles. --Rôtkæppchen68 01:18, 14. Feb. 2014 (CET)
komisch .. jetzt gehts wieder .. habe neustart und gecleant. War nur die eine Seite Photon und es kam sinngem. "wiki foundation error", während andere wiki hier gingen. --217.84.127.174 01:42, 14. Feb. 2014 (CET)


Abschnitt kann - wenn gelesen - gelöscht werden von mir aus. --217.84.127.174 01:42, 14. Feb. 2014 (CET)

Das hat mit deinem PC nchts zu tun; durch Leeren des Caches oder Neustart kannst du das Problem in aller Regel nicht lösen. Der Fehler liegt auf dem Wikipedia-Server. --88.130.111.148 13:41, 14. Feb. 2014 (CET)

Hinweis: Für Fragen speziell zur Wikipedia gibt es ein eigenes Diskussionsforum: Fragen zur Wikipedia.

Archivierung dieses Abschnittes wurde gewünscht von: Löschen ist nicht. Ab ins Archiv. --Rôtkæppchen68 01:53, 14. Feb. 2014 (CET)

Bourbines?

Was das Wort bedeutet, ist klar (unfreundlicher Ausdruck der Welschen für die Deutschschweizer). Aber kennt jemand die Herleitung/Wortherkunft? Danke. - Créteille (Diskussion) 22:03, 10. Feb. 2014 (CET)

Schwierig. Auch mal hier beobachten... GEEZER… nil nisi bene 08:18, 11. Feb. 2014 (CET)
Falls es mit bourbin (Gestammel) verwandt ist, fiele es in die Wortfamilie von borvo; es hätte das gleiche Motiv wie das Wort „Barbar“. --Pp.paul.4 (Diskussion) 09:32, 11. Feb. 2014 (CET)

Autobahnsee

Da ich gerade an dieser Begriffsklärung herumschraube stellt sich mir die Frage, ob man sagen kann, dass alle Autobahnseen Baggerseen sind. Danke im Voraus für alle Antworten --Impériale (Diskussion) 23:04, 10. Feb. 2014 (CET)

Was diese Seen gemeinsam haben ist, dass sie alle bei Adis aller erster Autobahn durch Materialaushub entstanden sind. Deshalb haben sie im Laufe der Zeit vom Volksmund diesen Namen gekommen. --El bes (Diskussion) 23:22, 10. Feb. 2014 (CET)
Das gab´s auch noch später. Die heißen nur nicht alle Autobahnsee XY. --Optimum (Diskussion) 23:45, 10. Feb. 2014 (CET)
Streich den ersten Satz doch einfach. Der grenzt an Theoriefindung und die Begriffsklärung erfüllt ihren Zweck ohne den Satz vollkommen. 217.230.125.191 09:54, 11. Feb. 2014 (CET)

Löslichkeit und Stabilität verschiedener Phytohormone

Moin,

mich interessiert die Hitzestabilität von NAA, BAP, Gibberellinsäure und Triacontanol. Zerfallen diese Verbindungen schon bei 121°C oder wie finde ich heraus, wie stabil die Verbindungen sind? Ist da der Schmelzpunkt ausschlaggebend oder kann schon bei niedrigeren Temperaturen was passieren?

Kann ich außerdem eine Lösung mit den Hormonen herstellen, indem ich NAA und Gibberellinsäure (je 100 mg) mit 1 g KOH in 100 ml Wasser löse? Kann ich BAP auch mit KOH lösen oder sollte da besser eine Säure genommen werden? Und wie kann ich Triacontanol lösen?

Ich möchte keine Alkohole zur Lösung verwenden.

--Involuntarius (Diskussion) 23:55, 10. Feb. 2014 (CET)

  • Stabilität: In den Infoboxen (rechts) folgst du unter "Eigenschaften" den Links - z.B. NAA ganz runterscrollen.
  • Löslichkeit: Ebenso - oder du suchst mit Google => "Name" "solubility in" <= Da findest du z.B. "Solubility: Stock solutions of 6-Benzylaminopurine are prepared at a concentration of 1 mg/ml. The solvents of choice are e.g. 25 % (v/v) aqueous DMSO (2) or dissolving BAP in a small volume of 2 N NaOH and subsequent dilution to 1 mg/ml with water. A more complex buffered solution is described in ref. 1." DMSO ist sehr nützlich. ...oder hast du einen Merck Index in Griffweite? GEEZER… nil nisi bene 07:51, 11. Feb. 2014 (CET)
Tricontanol Hier Löslichkeitshinweise - auch da funzt DMSO. GEEZER… nil nisi bene 10:16, 11. Feb. 2014 (CET)
Danke für die Hinweise. Allerdings finde ich recht ungenaue Angaben. Kann ich denn davon ausgehen, dass der Stoff nicht zerfällt, wenn ich deutlich unter dem Schmelzpunkt bleibe? Und für 100 mg Triacontanol brauche ich dann ja einige Liter Wasser zum lösen. Und wenn ich DSMO nutze, kann das in (dann sehr geringer Konzentration) den Pflanzen noch schaden? Es geht übrigens nicht um Cannabis, sondern um Orchideen (Phalaenopsis) und die Verwendung der Phytohormone in Nährböden.

KOH und NaOH scheinen mir nützlicher zu sein, weil ich das ganze ja recht problemlos neutralisieren kann, oder nicht? --Involuntarius (Diskussion) 15:24, 11. Feb. 2014 (CET)

Jaja, es wird Zeit, sich über einen möglichst hohen Ertrag Gedanken zu machen. Beachte bitte, daß allgemein davon abgeraten wird, die Pflanzen der ersten Generation nach den Manipulationen zu rauchen. 2A02:8108:1200:83C:A13A:347B:101C:6B7E 10:01, 11. Feb. 2014 (CET)

Hochladen urheberrechtlich geschützter Texte / Fotos als Quelle

Wie kann man urheberrechtlich geschützter Texte / Fotos als Quelle für Artikel bei Wikipedia hochladen, dass sie nur für befugte Personen, aber nicht für normale Besucher einsehbar sind? Ich habe einmal gehört, dass dies mit einer E-Mail gemacht wurde, die als Bestätigung für eine Aussage in einem Artikel als Antwort eingeholt wurde. Die E-Mail selbst ist bei Wikipedia nur für bestimmte Personen einsehbar.

Ernst Litter
Rebecca
Plakat für den Film von Alfred Hitchcock (Deutschland, 1951)
(Bitte Urheberrechte beachten)
(Ein Work-around) Bitte nur klicken, wenn Sie befugt sind - aber ehrlich..!

--Sassenburger (Diskussion) 02:34, 11. Feb. 2014 (CET)

E-Mail: info-de at wikimedia.org --93.133.113.239 06:51, 11. Feb. 2014 (CET)
Geht nicht. Wie soll WP wissen, wer "befugt" und wer "unbefugt" ist? Man läd hoch, nachdem man die Freigabelizenz hat. GEEZER… nil nisi bene 07:41, 11. Feb. 2014 (CET)
Zu Urheberrechtsfragen hier fragen (nur Rechtsfragen, kein Technik-Krempel). GEEZER… nil nisi bene 10:25, 11. Feb. 2014 (CET)

The day we fight back, warum ohne Wikipedia ?

Warum beteiligt sich Wikipedia nicht an dem heutigen Aktionstag "The day we fight back"

Gruß, Lars --85.243.13.112 08:55, 11. Feb. 2014 (CET)

Hinweis: Für Fragen speziell zur Wikipedia gibt es ein eigenes Diskussionsforum: Fragen zur Wikipedia.

https://de.wikipedia.org/wiki/Wikipedia:Auskunft/Archiv/2014/Woche_06#Wikipedia_und_die_Massen.C3.BCberwachung --Vsop (Diskussion) 09:55, 11. Feb. 2014 (CET)

krankengeld oder alg 2 nach erkrankung kurz vor ende von alg 1 ?

Ich beziehe noch wenige tage alg 1, viel weniger als 6 wochen, und bin heute krankgeschrieben worden. Krankheit endet nach der bezugsdauer von alg 1. Ich finde partut nicht raus wer mir danach in welcher höhe was zahlt, im Netz finde ich da zig sich wiedersprechende varianten! Wer kann da was zu sagen? Bitte nicht einfach aus alg-foren zitieren, die kenne ich schon! Danke vielmals. --212.23.103.132 11:10, 11. Feb. 2014 (CET)

Rechtshinweis Bitte den Hinweis zu Rechtsthemen beachten!
Hallo! Hier ist keine Rechtsberatung, also wirst Du keine abschließende Auskunft bekommen, welche der sich widersprechenden Varianten nun stimmt. Denn ganz ehrlich, aus Deinen wenigen Angaben kann man auch keine seriöse Antwort ableiten. Zusammengefasst - Du bekommst ab dem Tag der Krankschreibung sechs Wochen Krankengeld vom Arbeitsamt in der Höhe der letzten Leistung, anschließend ggf. Krankengeld durch die Krankenkasse in selber Höhe. Theoretisch schließt sich an die Tage der Krankheit noch die Restlaufzeit von ALG 1 für diese "wenige Tage" an. Wenn bisher kein Anspruch auf ALG 2 bestand, dann auch nicht während der Zeit der Erkrankung. Ob danach ein Anspruch auf ALG 2 besteht, kann hier angesichts der Komplexität dieser Frage nicht geantwortet werden.Oliver S.Y. (Diskussion) 11:19, 11. Feb. 2014 (CET)

Du schreibst jetzt ich bekäme 6 Wochen KG vom AA, danach den Rest ALG 1. Das ist doch ganz sicher falsch, so viel weiss ja sogar ich. Der ALG 1 Bezug läuft auf jeden Fall noch bis zum Ende des Bezugszeitraums, nach der Krankheit ist der weg. --212.23.103.132 11:30, 11. Feb. 2014 (CET)

Edit, meine Erfahrung beruht auf nen Fall, wo noch 3 Monate ALG 1 Bezug war. Bei wenigen Tagen gibt es danach kein ALG 1 mehr, hast Recht. Meinte, nach der Zahlung von Krankengeld durch die Krankenkasse.Oliver S.Y. (Diskussion) 11:50, 11. Feb. 2014 (CET)

Hat vllt wenigstens jmd Ahnung wo das geregelt ist, dann such ich selbst weiter! --212.23.103.132 14:24, 11. Feb. 2014 (CET)

Ganz allgemein gesprochen (Rechtsberatung im Einzelfall kann es hier nicht geben, wie Oliver bereits zutreffend gesagt hat):
Erkrankt ein Arbeitssuchender während des Bezugs von Arbeitslosengeld I, hindert das die Weiterzahlung des Arbeitslosengeldes grundsätzlich nicht. Der Anspruch läuft also im Normalfall weiter, bis entweder sechs Wochen um sind oder bis der Bezugszeitraum abgelaufen ist - je nach dem, was zuerst eintritt. Danach besteht die Möglichkeit, von der Krankenkasse weiter Krankengeld zu beziehen. Die Voraussetzungen dafür sind strenger als für den Bezug von Entgeltfortzahlung durch den Arbeitgeber, also unbedingt frühzeitig beraten lassen - auch wegen der erforderlichen Schritte nach Ende der Arbeitsunfähigkeit. --Snevern 16:00, 11. Feb. 2014 (CET)

Elfstellige Zolltarifnummern für den Import finden

Liebe Auskunft, ich suche für verschiedene Waren die elfstelligen Zolltarifnummern, die beim Import verwendet werden müssen. Beim Statistischen Bundesamt [7] finde ich nur die achtstelligen Nummern für den Export. Vielen Dank für Antworten! --BlackEyedLion (Diskussion) 11:29, 11. Feb. 2014 (CET)

Zumindest die 10-stellige Nummer findest Du beim TARIC durch Blättern. Die elfte Stelle ist soweit ich weiß nicht Pflicht für die Anmeldung, und wird ggf. beim Zollamt ergänzt, da sie ein nationales Merkmal ist, und dementsprechend nicht unbedingt das Deutsche sein muss.Oliver S.Y. (Diskussion) 11:36, 11. Feb. 2014 (CET)

Die 8er-Nummer hast du, dir fehlt noch 9/10 und 11, <= das wird da beschrieben. GEEZER… nil nisi bene 11:41, 11. Feb. 2014 (CET)
Wo finde ich denn, ob für die Waren gemeinschaftliche Maßnahmen gelten oder statistische Gründe eine Ziffer an der elften Stelle erfordern? --BlackEyedLion (Diskussion) 12:14, 11. Feb. 2014 (CET)
Die gemeinschaftlichen Maßnahmen habe ich gefunden: [8], ich sehe dort aber auch nicht, welche Nummer aus einer Maßnahme folgt. --BlackEyedLion (Diskussion) 12:28, 11. Feb. 2014 (CET)
Die zuständige Zollbehörde müsste helfen können. Die müssen sich ja schließlich täglich damit auseinandersetzen.--Giftzwerg 88 (Diskussion) 13:10, 11. Feb. 2014 (CET)
Ganz einfach. Du rufst direkt beim Zoll an. Das habe ich schon häufig getan und die sind ausgesprochen hilfsbereit. --2003:66:8E38:1201:A951:92C3:36AC:7157 14:07, 11. Feb. 2014 (CET)
Einfach hier [9] nachschlagen. Ist zwar typische benutzerfreundliche Behördensoftware, habe bisher aber alles gefunden. Tip: Du wählst Import oder Export und gehst dann zum Unterpunkt "Einreihung". Dann ist irgendwo die Stichwortsuche. Fröhliches rumsuchen. --P●C●P (Disk) 15:06, 11. Feb. 2014 (CET)

ISDN-Telefon

Liebe Wikipedianer, ich habe mir ein neues Gigaset-Telefon gekauft, weil bei dem alten was kaputt war. Jetzt habe ich versucht, das Telefonkabel (also NICHT den Netzstecker) in die Telefonbuchse einzuführen und habe entdeckt, dass das Telefonkabel des alten Telefons in so eine von den vielen weißen Plastikkästen führt, die bei mir an der Wand hängen. Nach dem Abmontieren des Kunststoffdeckels machte ich die Entdeckung, dass hier nicht ein Stecker in eine Telefonbuchse führte, sondern dass das Kabel mittels eines elektronischen Bauteils auf einer Leiterplatte befestigt war, eine Verbindung, die ich nicht einfach wie einen Stecker lösen konnte. Wie wechsele ich denn jetzt das Telefon? Kann ich einfach das Telefonkabel des alten Telefons auf der Leiterplatte lassen und das neue Telefon mit diesem Kabel anschließen? Das wäre ja das einfachste. Oder geht das aus irgendeinem Grund nicht? Ich will ja auch nichts kaputt machen. Vielen Dank für die Hilfe!--84.160.250.200 15:12, 10. Feb. 2014 (CET)

Das kann verschiedenes sein – hast Du mal ein Foto vom Tatort? Beste Grüße —[ˈjøːˌmaˑ] 15:27, 10. Feb. 2014 (CET)
Wenn der Stecker passt, sollte das kein Problem sein. --Vsop (Diskussion) 15:47, 10. Feb. 2014 (CET)
NTBA-Anschlüsse
NTBA innen
Die Kiste ist vermutlich ein NTBA. Versuche zu entziffern, was da neben den elektronischen Bauelementen auf der Leiterplatte steht, wo Dein altes Telefon angeschlossen ist. Sind das vier Drähte mit den Bezeichnungen a1, b1, a2 und b2 (Innenbild oranger Klemmenblock), so kannst Du diese abklemmen (Hebel drücken und Draht herausziehen). Vorher aber die Drähte kennzeichnen, falls Du das rückgängig machen willst. Steht neben den Klemmen a und b oder La und Lb (Innenbild grauer Klemmenblock), so ist das die Amtsleitung, die Du auf keinen Fall abklemmen solltest, weil das Telefon sonst nicht mehr funktioniert. Du kannst diesen Schritt aber einfach überspringen. Schau auf die Unterseite des NTBA-Kastens. Da sind drei Westernbuchsen. Zwei davon sind nebeneinander (Bild mitte), die dritte etwas abgesetzt mit codiertem Stecker (Bild links). In eine der zwei nebeneinanderliegenden Buchsen sollte Dein neues ISDN-Telefon passen. Falls Du Dich entscheidest, die alte per Aderklemmen angeklemmte Telefonleitung abzuklemmen, müssen evtl die Einstellungen des DIP-Schalters (unter dem Klemmenblock) angepasst werden. --Rôtkæppchen68 20:06, 10. Feb. 2014 (CET)
Ich hab mal meinen alten NTBA ausgegraben. Da sind beide Klemmblöcke grün, an dem der Amtsleitung steht „Uk0“, an dem zum Telefon steht „S0“. Bei den DIP-Schaltern gibt es zwei, die mit „100 Ohm“ beschriftet sind. Wenn Du die Adern von der S0-Klemme entfernst, müssen die beiden 100-Ohm-Schalter auf „On“ stehen. --Rôtkæppchen68 20:42, 10. Feb. 2014 (CET)

Also ich erkenne hier nichts wieder, was meinem Anschluss ähnlich sieht. Bei mir ist das Kabel mit einem schwarzen quadratischen Kunststoffteil auf der Leiterplatte befestigt und oben sieht man offene goldene Kontakte.--84.160.224.189 09:20, 11. Feb. 2014 (CET)

Mach mal ein Foto, lade das bei einer Gratisbilderhostingplattform hoch und poste den Link hier. Vielleicht können wir Dir dann weiterhelfen. --Rôtkæppchen68 09:30, 11. Feb. 2014 (CET)
Irgendwie glaube ich, dass der Fragesteller / die Fragestellerin eine Verbinderdose hat, wo nur das Kabel rauskommt aber kein Stecker ist. Gruß kandschwar (Diskussion) 23:03, 11. Feb. 2014 (CET)
<quetsch> Verbinderdosen können eine kleine Platine mit einem PPA haben. Die sitzt allerdings vor einem NTBA. Gruss --Nightflyer (Diskussion) 00:27, 12. Feb. 2014 (CET)
Die vergoldeten Kontakte sprechen dagegen. Verbinderdosen verwendeten verzinnte Kontakte. Es könnte allerdings eine Pfostensteckverbindung (siehe Stiftleiste) sein. So etwas hab ich bisher aber nur bei Analogtelefonen von Nebenstellenanlagen gesehen. --Rôtkæppchen68 00:13, 12. Feb. 2014 (CET)

Freigabe/Online eines Artikels durch Wikipedia?

Hallo, Ende Januar habe ich einen Artikel entworfen und freigegeben. Leider ist seitdem nichts passiert - auch keine Diskussion (so gehe ich auch davon aus, dass alles korrekt ist), aber auch keine "Freischaltung" i.d.S., dass der Artikel jetzt aus Wikipedia zu finden ist. Wie lange muss durchschnittlich gewartet werden?--Red Indians Publishing (Diskussion) 15:56, 10. Feb. 2014 (CET)

--Red Indians Publishing (Diskussion) 15:56, 10. Feb. 2014 (CET)

Hinweis: Für Fragen speziell zur Wikipedia gibt es ein eigenes Diskussionsforum: Fragen zur Wikipedia XenonX3 – () 16:09, 10. Feb. 2014 (CET)
Von alleine passiert da gar nichts. Wenn du deinen Artikel im Artikelnamensraum haben möchtest, musst du ihn selbst dorthin verschieben. XenonX3 – () 16:09, 10. Feb. 2014 (CET)
Genau so ist es. Die Seite Benutzer:Red_Indians_Publishing/Artikelentwurf ist in deinem Benutzernamensraum und deshalb geht da auch keiner dran. Du kannst die Seite verschieben nach Michael Köckritz und damit ist sie dann Teil der Artikel in Wikipedia. :-) --88.130.67.161 16:18, 10. Feb. 2014 (CET)
Insgesamt kann man Dir das aber nicht empfehlen, weil er dann quasi instant gelöscht werden würde. Bitte mal WP:H, WP:ART und vor allem WP:RK studieren und erst noch mal ein bisschen überarbeiten ... --He3nry Disk. 16:21, 10. Feb. 2014 (CET)
Ach, nun kommt schon, immerhin die Rechtschreibung ist "Avantgard" :-) --FA2010 (Diskussion) 16:43, 10. Feb. 2014 (CET)
Als Alleinstellungsmerkmal wäre vielleicht das jugendliche Alter des Juniorpartners und die Besonderheit des Taufritus hervorzuheben: "Zusammen mit seinem Partner Christian Gläsel wurde 2007 der Independent-Verlag Red Indians Publishing aus der Taufe gehoben". SCNR Dumbox (Diskussion) 17:12, 10. Feb. 2014 (CET)
Herausgeber und Chefredakteur einer mit relevanten Preisen ausgezeichneten Zeitschrift zu sein wäre für die Person ja schon relevanzstiftend. Spontanes Googlen offenbart, dass "ramp" eine ganze Reihe Mercury Awards und u.a. den LeadAward der LeadAcademy bekommen hat. Bei diesen Auszeichnungen hat ramp immerhin so namhafte Titel wie "Auto Motor und Sport" oder "Autobild" hinter sich gelassen. Inwiefern das Heft jetzt dadurch relevant wird, ist so eine Frage; aber glasklare Irrelevanz sieht schonmal anders aus. --88.130.67.161 17:25, 10. Feb. 2014 (CET)
Sehe ich nicht so. Es geht um einen Personenartikel, oder? Der Artikelentwurf ruft recht laut nach Überarbeitung. Und die RK sind auch dünn. Ein Sachbuch bei Edel / earBOOKS Hamburg und ein Hörbuch immerhin bei Bastei Lübbe. Das allein reicht aber nicht. Dann die Tätigkeit als Verleger, aber nix über Auflagen und Reichweite, Wirkung und gesellschaftlichen Stellenwert. Das ist nicht abwertend gemeint, aber sehr viele Unternehmer, die sehr hart in ihren Betrieben arbeiten und gute Produkte herstellen, schaffen auch nicht die Relevanzhürde. Insgesamt offenbar ein Mißverständnis oder ein Verwechseln von Enzyklopädie und Werbeplattform. Ich empfehle dringend auch die Lektüre von Wikipedia:Interessenkonflikt und für die eigene mentale Vorbereitung einen Blick auf einige Tagesseiten in der Löschhölle. --84.191.132.1 18:05, 10. Feb. 2014 (CET)
Wie du etwas siehst ist für Wikipedia irrelevant. Die WP:RK für Autoren sehe ich nicht erfüllt, höchstens die für Herausgeber relevanten Bereiche, daher meine Einlassungen ausschließlich dazu. Die RK lassen bereits eine Arbeitsleistung genügen, die als herausragend anerkannt worden und dauerhaft von Bedeutung ist. Das wäre zu zeigen. "ramp" hat eine ganze Reihe Mercury Awards gewonnen und u.a. den LeadAward der LeadAcademy bekommen. Bei diesen Auszeichnungen hat ramp immerhin so namhafte Titel wie "Auto Motor und Sport" oder "Autobild" hinter sich gelassen. Herausragend ist das Heft damit mMn; die Frage ist nur noch die Folgende: Ab wann ist eine solche Publikation "dauerhaft" von Bedeutung? Sicher ist nur, dass wir hier nicht von Jahrzehnten reden. "ramp" gibt es seit 2007/2008; also seit 6, 7 Jahren. Das ist jetzt auch nicht so kurz. Glasklare Irrelevanz sieht anders aus. --88.130.67.161 00:31, 11. Feb. 2014 (CET)
Wenn der Ersteller sich schon hier verewigen möchte, wäre ein Artikel über die preisgekrönte Zeitschrift wohl erheblich aussichtsreicher. Und für den Anfang weniger konfliktträchtig und lösch-gefährdet. Da könnte man auch elegant den eigenen Namen als Herausgeber mit einfließen lassen... Macht natürlich nicht soviel Eindruck wie der Personenartikel... --> Ramp (Zeitschrift) Solaris3 (Diskussion) 19:00, 10. Feb. 2014 (CET)
FULLACK. --88.130.67.161 00:31, 11. Feb. 2014 (CET)
Fazit(?): Der Artikel scheint relevant zu sein (durch die vielen namhaften Auszeichnungen und die Beachtung in den Medien und die Vernetzung im Komplex red indains + ramp + rampstyle + weitere Veröffentlichungen / Projekte), dürfte also vor einem °spotnanen° Löschen bei Verschiebung nach Michael Köckritz , dadurch im Wikipedia:Artikelnamensraum befindlich, geschützt sein. Zur Sicherheit könnte zusätzlich eine Qualitässicherung - fach-un-spezifisch per " Setze ganz oben in den Artikel: {{subst:QS|Deine Begründung --~~~~}} " oder vielleicht fachspezifisch unter QS-Medienwissenschaft (? habe nix besseres gefunden) per {{QS-Medienwissenschaft}} (?), {{subst:QS-Medienwissenschaft|neuer Artikel}} (? Bitte korrigierend editieren!) ) den Artikel zusätzlich legitimieren (von da, wo er jetzt ist, bevor er in den Artikelnamensraum kommt). --84.137.117.108 18:43, 11. Feb. 2014 (CET)
Ich hab die Bapperln mal ergänzt. --88.130.105.207 19:50, 11. Feb. 2014 (CET)

Sind alle Stoffe semi-flüssig?

Wie beim Teertropfenexperiment, der alle paar Jahre tropft. Würde beispielsweise ein Stück Kalkstein in geologischen Zeiten oder sagen wir kosmologischen Zeiträumen flach fließen? Zum Beispiel wenn man 1000 Mrd Jahre wartet? 2001:4C28:4000:721:185:26:182:27 21:28, 10. Feb. 2014 (CET)

Nein. Kristalline Stoffe haben eine inhärente hohe Stabilität, die das Fließen verhindert, und die aus dem Kristallgitter resultiert. Teflon z.B. ist ein Gemisch von langen Molekülketten/knäueln ohne Gitterstruktur. Fensterglas hat ebenfalls kein Gitter, sondern ist ein amorpher Brei, daher fließt es extrem langsam. Solaris3 (Diskussion) 21:32, 10. Feb. 2014 (CET)
Würde Glas also auf lange Sicht gesehen die Hauswand runter fließen und auf den Gehwegplatten eine Pfütze bilden? 2001:4C28:4000:721:185:26:182:27 21:35, 10. Feb. 2014 (CET)
Nur nach extrem langer Zeit, siehe hier. --Cubefox (Diskussion) 22:26, 10. Feb. 2014 (CET)
(nach BK) Auf einer gigantisch langen Zeitskala (Milliarden von Jahren reichen da wahrscheinlich nicht aus) würden sich auch Kalkstein und sonstige Festkörper etwas verändern. Die nötige Energie zur Umordnung von Atomen ist dort aber so hoch, dass es bei Raumtemperatur extrem lange dauert. Der Unterschied zum Pechtropfenexperiment ist aber, dass beim Kalkstein die Umordnung Atom für Atom erfolgen würde, nicht als kollektives Fließen. Insofern gibt es durchaus einen Unterschied zwischen Flüssigkeiten (wie Pech) und Festkörpern (wie Kalkstein). --mfb (Diskussion) 21:34, 10. Feb. 2014 (CET)
(nach neuem BK) Zum Glas: Nein! Glas hat keine Kristallstruktur und somit keine Fernordnung, aber durchaus eine feste Nahordnung. Das lässt kein Fließen zu. --mfb (Diskussion) 21:38, 10. Feb. 2014 (CET)
(BK²)Fensterglas und viele Kunststoffe sind teilkristallin und fließen deswegen nicht bis kaum. Kristalline Stoffe können sich dennoch im Laufe der Zeit verändern, insbesondere wenn die Kristallstruktur Störstellen besitzt. Metastabile Kristalle verändern sich auch sehr langsam. --Rôtkæppchen68 21:39, 10. Feb. 2014 (CET)
"On this timescale, all matter is liquid."
Bereits in geologischen Zeiträumen verhält sich auch festes Gestein gewissermaßen wie eine Flüssigkeit, wenn vielleicht auch nicht im strengen physikalischen Sinne. --Florian Blaschke (Diskussion) 03:12, 11. Feb. 2014 (CET)
evtl. wenn man mit temperatur und druck ein bissl spielen würde? kalkstein besteht aus Calciumcarbonat... vielleicht wirds suprafluid ;) ? --Asteroidenbergbauer (Diskussion) 12:48, 11. Feb. 2014 (CET)
Kann man vielleicht auch sagen, ab einer bestimmten Größe/Masse verhält sich alles irgendwie flüssig? Also ich meine in der Größenordnung von Monden und Planeten, wo sich alles alleine von der Gravitation immer zwangsläufig in eine ungefähre Kugel formt. --Neitram  13:23, 11. Feb. 2014 (CET)
... und wenn sie wieder auftauchen, dann frieren diese Wellen regelrecht wieder ein (hier ein sogenannter Flinz).
Temperatur und Druck sind (neben Zeit) gute Stichworte. Unter passenden Bedingungen können auch Festkörper regelrecht Wellen schlagen. Bei extremen Temperaturen und Drücken finden darüber hinaus aber auch beachtliche chemische Umwandlungen der betroffenen Gesteine statt. Nachher ist ihre Zusammensetzung nicht mehr genau die, die sie vorher war, und dieser Prozess ist wohl etwas komplexer, als nur ein bloßes "Fließen". Geoz (Diskussion) 18:53, 11. Feb. 2014 (CET)
Die Begriffe Fest und Flüssig heißen nicht einfach „überhaupt absolut gar nicht verformbar“ und „verformbar“. Sie beziehen sich auf verschiedene Phasen eines Stoffes, die qualitativ unterschiedliche Merkmale aufweisen (in der Ordnung, in der Bindung…). --Chricho ¹ ² ³ 23:37, 11. Feb. 2014 (CET)

Wikimedia Error technical problem

Hallo, in letzter Zeit bekomme ich öfters die Meldung Wikimedia Error.
Dies ist besonders ärgerlich wenn man gerade eine Artikeländerung speichern möchte. Kann dieses Problem nicht behoben werden?

Wikimedia Error Beispiel

--Duke Q (Diskussion) 23:34, 10. Feb. 2014 (CET)

Meinst du das jetzt ernst oder ist das als Scherz zu verstehen? --84.191.135.120 03:42, 11. Feb. 2014 (CET)
Gibts ein paar Mal die Woche, entweder als Fehler oder als Schreibschutz (Server akt.). Näheres siehe WP:Server --93.133.113.239 06:44, 11. Feb. 2014 (CET)
Du bekommst wahrscheinlich deine Änderungen zurück, wenn du bei der Fehlermeldung den Zurück-Knopf deine Browsers drückst. Du kannst dann versuchen, sie nochmal abzusenden, oder sie dir rauskopieren. --Eike (Diskussion) 08:38, 11. Feb. 2014 (CET)
Wenn man auf "zurück" drückt ist es manchmal so, dass die Textänderung weg ist. Ich warte in solchen Situationen einfach ein bisschen und drück dann - noch auf der Fehlerseite - "Seite neu laden". Der Browser zeigt mir ein Fenster, dass die gesendeten Daten dann nochmal gesendet würden und ob ich das auch wirklich wollen würde. Ich drück auf "Ja" und alles ist gut! --88.130.105.207 19:12, 11. Feb. 2014 (CET)

Hinweis: Für Fragen speziell zur Wikipedia gibt es ein eigenes Diskussionsforum: Fragen zur Wikipedia.

Magnus Gäfgen Entlassung aus der Haft

Wann kann der Kindermörder frühstens wieder auf freiem Fuß gesetzt werden? Warum wird bei lebenslang wieder Gnade gezeigt gerade gegenüber einem Vergewaltiger?--09:39, 11. Feb. 2014 (CET) (ohne Benutzername signierter Beitrag von 84.162.230.126 (Diskussion))

Diskussion:Magnus Gäfgen#Haftentlassung, http://dejure.org/gesetze/StGB/57a.html --Vsop (Diskussion) 09:52, 11. Feb. 2014 (CET)
Beantworte nicht meine Frage, ob er nun eine Chance hat frei zu kommen wenn ja wann?? Was sind die Bedingungen?--84.162.230.126 11:11, 11. Feb. 2014 (CET)
Man kann auch trotz der Feststellung der Schwere der Schuld bereits nach 16 Jahren freikommen, siehe dazu Sedlmayr-Mörder aus Haft entlassen Also in Gäfgens Fall frühestens Fall 2018 (Festnahme 2002 + 16 Jahre). Und was die Chancen angeht: ich hoffe er kriegt keine. Ich hoffe er vermodert in der Zelle. Oder sitzt das Minimum von durchschnittlich 22 Jahren ab, also Entlassung frühestens 2024. --Jack User (Diskussion) 11:14, 11. Feb. 2014 (CET)
Wie kommst du auf "Vergewaltiger"?!? Hört sich an, als würdest du hier Üble Nachrede betreiben. --Eike (Diskussion) 11:54, 11. Feb. 2014 (CET)
Üble Nachrede? Einen Kindsmörder lediglich einen Vergewaltiger nennen? --Jack User (Diskussion) 12:02, 11. Feb. 2014 (CET)
Ich hab's ja verlinkt, lies es einfach nach. --Eike (Diskussion) 12:08, 11. Feb. 2014 (CET)
Gnade zeigen ist etwas anderes. Vielleicht als Hinweis, damit das hier nicht auf dem untersten Niveau bleibt, ein paar Worte zum Thema Strafzwecktheorien: Bei Delinquenz, zum Teil auch bei Devianz gibt es zwei gedankliche Ansätze, die miteinander verwoben sind und das gesellschaftliche Handel bestimmen: Zum einen will die Gesellschaft sich schützen, zum anderen soll ein bestimmtes Handeln bestraft werden. Hinter der Idee der Strafe stehen im Wesentlichen drei Ziele:
  • die Erwartung, daß Strafe individuell und gesellschaftlich zur Prävention, also zur Abschreckung beiträgt,
  • daß, soweit das überhaupt möglich ist, gesellschaftlich ein Zustand von Gerechtigkeit wiederhergestellt und das Vergehen gesühnt wird
  • und daß das Talionsprinzip zum Tragen kommt, dem Täter also ein, soweit möglich, vergleichbarer Schaden entsteht wie dem Opfer. Auch hier spielt, allerdings individuell, die Gerechtigkeit und das Ziel eines Ausgleichs die zentrale Rolle. (Im anglo-amerikanischen Rechtssystem finden wir noch das System der punitive damages, das dem Geschädigten einen Ausgleich über den tatsächlich erlittenen Schaden hinaus zuerkennt.)
In aufgeklärten humanistischen Rechtssystemen kommen bei der Bestimmung des Strafmaßes noch zwei Aspekte hinzu. Es wird das Zustandekommen der Straftat, die Tatumstände und das Alter und die Persönlichkeit des Täters berücksichtigt. Außerdem gibt es die Vorstellung, daß die meisten Menschen veränderbar seien und deshalb das Ziel der Resozialisierung und der Integration in die Gesellschaft (was sowohl von Vorstellungen der Humanität als auch der Prävention getragen wird). Jeder Mensch, auch der Schlimmste, hat eine zweite Chance. Man kann das als eine erstrebenswerte humane Wertvorstellung ansehen und dennoch angesichts der Schwere von Straftaten ein Unbehagen haben. Und weil durch den Jahrestag gerade Fritz Bauer und die Auschwitzprozesse verstärkt in den Medien auftauchen liegt es nahe, z.B. auch an die vielen unbestraften Nazi-Massenmörder zu denken, die weitgehend unbehelligt blieben.
Es liegt in der Natur der Sache, daß es seit der Erfindung der Strafe schon immer Uneinigkeit und Unzufriedenheit über Strafen und Strafhöhen gegeben hat. Die Dimension des Schreckens mancher Taten ist kaum faßbar, noch weniger, wie es überhaupt möglich sein soll, Ausgleiche herzustellen. Selbst der alte hebräische Rechtssatz Auge für Auge hat ja Grenzen. Oder wäre in der Anwendung sinnlos: Was macht man mit einem 13jährigen Jungen, der ein Haus angezündet und Menschen getötet hat? Dazu kommt auch, daß die Rechtssysteme von Menschen getragen werden und damit für menschliche Schwäche anfällig sind. Man denke nur an die Problematik der Gutachter und die vielen bekannten Irrtümer von Gutachtern.
Außerdem ist das Rechtssystem von den Interessen äußerer politischer und wirtschaftlicher Macht bedroht. Fast jeder hat irgendwann schonmal gedacht "Die Kleinen hängt man und die Großen läßt man laufen". Und die Politiker machen nicht nur die Gesetze, sie bestimmen auch, wen diese Gesetze prüft und auslegt. Zitat:
"Schmidt: (...) Das berührt übrigens ein verfassungsrechtliches Problem, das in keiner der westlichen Demokratien gelöst ist, nämlich die Berufung der Obersten Richter. Die Berufung eines Verfassungsrichters geschieht in einem völlig undurchsichtigen Verfahren, das kein Außenstehender durchschauen und kontrollieren kann, einem sogenannten Richterwahlausschuss, der nach Parteienproporz zusammengesetzt ist. Das heißt, eine Handvoll Leute kungeln das untereinander aus. Dabei spielen sicher Befähigung und bisheriger Lebenslauf eine Rolle, aber leider Gottes spielt auch die parteipolitische Orientierung eine Rolle, eine viel zu große Rolle.
Steinbrück: Das gilt für alle Obersten Gerichte in Deutschland, nicht nur für das Bundesverfassungsgericht, und es gilt übrigens auch für die öffentlich-rechtlichen Rundfunkanstalten.
Schmidt: (...) Es ist in Wirklichkeit nirgendwo überzeugend gelöst."
(Helmut Schmidt, Peer Steinbrück: Zug um Zug, Hoffmann und Campe Verlag, Hamburg 2011, ISBN 9783455850130)
Eine Entlassung nach einer schweren Straftat findet also in einem wenig perfekten und anfälligen Rechtssystem statt und unterliegt der völlig unterschiedlichen Bewertung und Beurteilung von vielen Millionen nur indirekt an dem Verfahren Beteiligten. Aber es haben sich auch eine Menge Leute eine Menge Gedanken gemacht und um gute oder bessere Lösungen miteinander gestritten. Dabei gab es auch Kompromisse. Auf den ersten Blick scheint es natürlich widersprüchlich, wenn der Begriff "Lebenslang" für die Höchststrafe verwendet wird, faktisch aber etwa ein Viertel einer Erwachsenen-Lebenszeit ausmacht. Das vermittelt nicht, was dahinter steht.
Ich bin mir aber andererseits sicher, daß die Erfüllung des inhumanen Wunsches "Ich hoffe er vermodert in der Zelle." auch in anderen gesellschaftlichen Bereichen zu entsprechend mittelalterlichen Zuständen führen würde. Wie gut ein Rechtssystem und die zugrundeliegenden Werte verankert und wirkmächtig sind zeigt sich nicht an den "kleinen" Fällen, wenn jemand Kaugummis klaut oder schwarz fährt. Wie gerecht wir wirklich sind, wie stabil und gut unser Rechtssystem ist, zeigt sich bei den besonders schlimmen, den schweren Fällen, wo es uns schwerfällt, den Tätern die gleiche Gerechtigkeit zukommen zu lassen und sie nach den gleichen grundlegenden Maßstäben zu behandeln wie andere bei weniger schweren Straftaten und auch bei ihnen die Rechte zu respektieren, die wir jedem Menschen zuerkennen. (Die Entlassung wird, wenn die Voraussetzungen gegeben sind, erfolgen, weil der Entlassene das Recht darauf hat.) Wenn wir unsere Rechtsgrundsätze aufgeben und uns von Gefühlen leiten lassen, sobald wir mit einer besonders schweren Straftat konfrontiert sind, ist unser Recht, so schlecht es subjektiv empfunden auch sein mag, nichts mehr wert. Dann herrscht nur noch die Gewalt, wer schneller zieht und genauer trifft. Schon ein Blick nach Russland, von dem Sportspektakel weg hin zu den korrupten Richtern, zu den Straflagern und den Enteigneten, auf deren Grundstücken nun Beckenbauer und Konsorten jubelnd herumlaufen, sollte uns nachdenklich machen. --84.191.135.120 16:12, 11. Feb. 2014 (CET)
Danke für diese kluge und besonnene Antwort. (Nicht, dass ich von dir etwas anderes erwartet hätte... ;-)). --Jossi (Diskussion) 18:44, 11. Feb. 2014 (CET)

Windows XP, IPv6 und der 8. April

Wie muss ich IPv6 bei Windows XP konfigurieren, dass damit keine Netzwerkverbindung außerhalb des lokalen Netzes möglich ist? Bei IPv4 ist das klar: Ich vergebe eine fixe IP-Adresse und lasse das Feld für den Gateway frei. Wenn ich einen lokalen DNS habe, kann ich den angeben. --91.47.19.149 10:09, 11. Feb. 2014 (CET)

Braucht IPv6 nicht genauso ein Gateway? --Eike (Diskussion) 10:45, 11. Feb. 2014 (CET)
Laut ipv6int.net ist die IPv6-Implementation von Windows XP unvollständig. Unter anderem fehlt DHCPv6. IPv6 funktioniert bei XP per “stateless autoconfiguration for local and global addresses”, also so etwas wie die IPv6-Variante von APIPA/Zeroconf. Der Knopf mit den Einstellungen ist bei Windows XP IPv6 gegraut. Manuell einstellen kann man da also nichts. ipv6int.net empfiehlt Dibbler - a portable DHCPv6 für Windows XP. Windows Server 2003 nutzt dieselbe Implementation von IPv6 wie Windows XP. Ab Windows Vista lässt sich IPv6 manuell konfigurieren. Ich stelle mir aber die Frage, ob es wirklich notwendig ist, eine DHCPv6-Software zu installieren, nur um diese Funktionalität aus Sicherheitsgründen zu deaktivieren. Ist ein per “stateless autoconfiguration for local and global addresses” konfigurierter Windows-XP-Rechner mit IPv6 wirklich global sichtbar? Ich habe noch kein Betriebssystem gesehen, das IPv6, aber kein IPv4 kann. Insofern müsste IPv4 für die LAN-interne Kommunikation mit einem Windows-XP-Rechner ausreichen. Aus meiner Sicht ist es also eine Lösung, IPv6 bei Windows XP einfach zu deinstallieren und nur IPv4 zu nutzen, wie es bis zur Veröffentlichung von IPv6 für Windows XP auch geklappt hat. --Rôtkæppchen68 16:09, 11. Feb. 2014 (CET)

Mal eine rechtliche Frage zu einer Krankenhausrechnung

Rechtshinweis Bitte den Hinweis zu Rechtsthemen beachten!

Hallo liebe Wikipedianer, vielleicht kennt einer von Euch diese Konstellation: Meine Tochter kam 26. ins Krankenhaus. Statt privat abzurechnen haben wir die Karte der gesetzlichen Krankenkasse hingelegt. In einem Anfall von Irrsinn, habe ich dann am 29., also am vierten Tag eine Wahlleistungserklärung unterschrieben. Jetzt kam nach über 1,5 Jahren eine Rechnung über 700 €. Muss ich die komplett bezahlen oder muss ich nur ab dem 29. bezahlen? Rolz-reus (Diskussion) 11:16, 11. Feb. 2014 (CET)

Rechtshinweis Bitte den Hinweis zu Rechtsthemen beachten!

Hallo! Bitte suche einen Rechtsanwalt oder eine andere Rechtsberatung auf. Anhand der wenigen Angaben kann man keine seriöse Auskunft geben, und es ist offensichtlich auch keine allgemeine Wissensfrage. Kurze Antwort, es zählt, was vertraglich vereinbart und unterschrieben wurde. Der Tag der Vereinbarung ist dabei unwesentlich, wenn wie hier solcher Bezug besteht. Ebenso kommt es auf die Rechnung an, ob überhaupt Leistungen für diese 4 Tage gefordert werden, oder für den Rest der Behandlung. Verjährt ist die Forderung aus der Rechnung aber noch nicht.Oliver S.Y. (Diskussion) 11:23, 11. Feb. 2014 (CET)

(2) Wahlleistungen sind vor der Erbringung schriftlich zu vereinbaren; der Patient ist vor Abschluss der Vereinbarung schriftlich über die Entgelte der Wahlleistungen und deren Inhalt im Einzelnen zu unterrichten. § 17 KEntgG (Gesetz über die Entgelte für voll- und teilstationäre Krankenhausleistungen) http://www.buzer.de/gesetz/507/al36508-0.htm --Vsop (Diskussion) 12:32, 11. Feb. 2014 (CET)
VSOP - nur ein kleiner Einwand, es kommt immer auf den Einzelfall an, und in welcher Fallgruppe dieser eingeordnet wird. Es gibt Fallgruppen, da wird nur zur Schriftform geraten, aber sie ist nicht verbindlich. Stichworte "Fehlende medizinische Indikation" und "Ambulante Behandlung". Rolz hat ja keine Details genannt, aber ich kenne aus dem Familienbereich Fälle, wo die Einlieferung Freitag Nachmittag nach Büroschluss erfolgt (26.er), mit dem Patienten bzw. dem Vertreter die Behandlung besprochen wird (auch aktenkundig), aber der Vertrag erst am Montag (29.er) aufgesetzt werden kann. Erscheint mir aus der Praxis heraus logisch, weil ansonsten viele Patienten trotz Zahlungswillens und -vermögens erst nach Tagen die gewünschte Leistung erhalten. Oliver S.Y. (Diskussion) 14:36, 11. Feb. 2014 (CET)

§ 17 Abs. 2 KHEntgG kann man angesichts seines klaren Wortlauts doch nicht kommentieren: "Es gibt Fallgruppen, da wird nur zur Schriftform geraten, aber sie ist nicht verbindlich." Das Schriftformerfordernis gilt kraft Gesetzes ohne jede Einschränkung. Das schließt es nicht aus, dass die Berufung des Patienten darauf im Einzelfall (ausnahmsweise) treuwidrig/rechtsmissbräuchlich erscheinen und deshalb unwirksam sein mag. Der Fall, dass am Freitag alles ausführlich erörtert wird, und dann fehlt es an dem Vertragsformular, zu dessen Unterzeichnung es deshalb erst am Montag kommt (vielleicht sogar mit Bezeichnung des Behandlungszeitraums ab Freitag), mag so beurteilt werden. Selbstverständlich kommt es immer auf den Einzelfall an. Doch "Fallgruppen", bei denen Schriftform nur empfohlen, aber nicht zwingend ist, sind im KHEntgG nicht vorgesehen. --Vsop (Diskussion) 16:04, 11. Feb. 2014 (CET)

Siehe [10] als Beispiel. Wollen wir uns hier wirklich über solche Auslegung streiten? Dann weise ich nochmal auf den Wortlaut hin, für das dieses Gesetz gilt, nämlich für andere als die "allgemeinen Krankenhausleistungen". Es muss sich dabei aber wie beschrieben um solche handeln. Ambulante Wahlleistungen fallen nicht unter dieses Gesetz, selbst wenn sie durch ein Krankenhaus durchgeführt werden, und wenn ich die Kommentare verstehe, auch nicht die allgemeinen Krankenhausleistungen, da diese in dem Fall auch Wahlleistungen zur ambulanten Behandlung sind. "Statt privat abzurechnen", also standen da auch Optionen zur Wahl, was im Normalfall nicht üblich ist.Oliver S.Y. (Diskussion) 16:33, 11. Feb. 2014 (CET)

Downloads FF 27

Bislang gingen meine Downloads problemlos an die unter Extras/Einstellungen/Allgemein eingestellte Festplatte E:. Seit Update FF 26 -> 27 verschwinden sie - trotz gegenteiliger Einstellung - irgendwo in einem Ordner "Downloads". Bug? Feature? Was kann ich tun? --80.129.145.34 11:51, 11. Feb. 2014 (CET)

Firefox 27 mag keine Root-Verzeichnisse als Ziel mehr (also C:\, E:\, etc.) Siehe hier. Workaround: erstelle zB ein Verzeichnis E:\Downloads als Ziel, oder E:\Dideldum etc. Solaris3 (Diskussion) 18:48, 11. Feb. 2014 (CET)

Danke, der Link war die Antwort. Auf C:\ (Windows Root) klappt es tatsächlich.--80.129.145.34 19:20, 11. Feb. 2014 (CET)

Also mit C: geht es, mit anderen wie D:, E: nicht. Sehr konsistent. Hatte gar nicht soweit gelesen, dass C: als einziges doch geht. Solaris3 (Diskussion) 20:22, 11. Feb. 2014 (CET)

Bitmap in SWF-Datei

Hallo zusammen. Schafft es einer, das Bild im Flash-Zoom-Viewer (rechts unten auf Zoomansicht klicken) zu extrahieren (möglichst in voller Auflösung) und mir gegebenenfalls per eMail zu schicken? Grüße  TRN 3.svg • hugarheimur RIP Klara Winter 16:07, 11. Feb. 2014 (CET)

Welches Bild? --AndreasPraefcke (Diskussion) 16:29, 11. Feb. 2014 (CET)

Mist… Das da meinte ich.  TRN 3.svg • hugarheimur RIP Klara Winter 16:33, 11. Feb. 2014 (CET)
Das ist notmales HTML, kein Flash. Allerdings hat dieses gemeinfreie Foto ein Wasserzeichen. Mist. --Rôtkæppchen68 17:01, 11. Feb. 2014 (CET)

Voila, das ist nun die Zoom-(Flash) Version. ohne Wasserzeichen. --Vsop (Diskussion) 17:28, 11. Feb. 2014 (CET)

Nu haste das Bild ohne Wasserzeichen und sogar mit seiner Frau Gemahlin ;) --Odeesi talk to me rate me 17:31, 11. Feb. 2014 (CET)
Danke euch allen. Eva heißt übrigens Sophie.
@Odeesi: Dein Bild ist allerdings eine Zeichnung und nicht völlig identisch, auch wenn sie ganz offensichtlich auf den beiden Fotos basiert. Trotzdem Danke ;o) Grüße  TRN 3.svg • hugarheimur RIP Klara Winter 18:35, 11. Feb. 2014 (CET)

Statistiken zu Straftaten in den USA

Hallo zusammen, ich habe eine Frage zu Statistiken über Straftaten in den Vereinigten Staaten. Konkret bin ich auf der Suche nach dem landesweiten Durchschnittswert der Verbrechensrate von 2011. Hier ist in der untersten Zeile ein Wert von 307.5 angegeben, also 307,5 Straftaten auf 100.000 Einwohner. Jetzt frage ich mich, ob das tatsächlich der Wert von 2011 ist? Das ist für mich nicht eindeutig. Ansonsten habe ich nur eine Veröffentlichung des FBI entdeckt, aber hier (im zweiten Absatz) werden nochmal ganz andere Werte genannt. Kann mir da jemand weiterhelfen? Das würde mir für zukünftige Artikelarbeit sehr weiterhelfen. LG Stefan 18:02, 11. Feb. 2014 (CET)

Die Seite mit den Daten aus Miami bezieht ihre Durchschnittszahlen wohl nur auf die darüber stehenden Verbrechen und sagt ja auch überhaupt nicht auf welches Jahr sich die 307,5 überhaupt beziehen. Zudem steht da auch das die manche Verbrechen scheinbar stärker werten, da wäre ich vorsichtig. Auf Seiten des FBI werden zwei angegeben, einmal für "violent crimes", also Gewaltverbrechen. Da sinds dann 386,3 pro 100.000 und "property crime", also Vermögensdelikte. 2908,7 auf 100000. --Lidius (Diskussion) 18:48, 11. Feb. 2014 (CET)
Das mit der Gewichtung hab ich schon verstanden, das macht ja auch Sinn. Aber es ist wirklich merkwürdig, dass da links unten einfach ein Wert steht und nicht erkennbar ist, auf welches Jahr er sich bezieht. :/ Das ganze auf Gewalt- und Vermögensdelikte aufzusplitten hatte ich eigentlich auch nicht vor... LG Stefan 19:22, 11. Feb. 2014 (CET)
Wie du auf 307.5 kommst erschließt sich mir nicht. Die Tabelle "City-data.com crime rate per 100,000 population" gibt für 2011 einen US-Durchschnittswert von 260 an. Die Tabelle "Crime rates in Miami Beach by Year" (mit der Angabe: "U.S. average = 307.5") enthält dort keinen Jahresbezug. Man könnte einen Schnitt aus dem Zeitraum 1999 bis 2011 vermuten, aber faktisch ist durch einen fehlenden Bezug diese Angabe nicht zu gebrauchen. --84.191.135.120 18:50, 11. Feb. 2014 (CET) Soweit ich sehe ist die City-data.com crime rate auch unpräzise ("serious", "more heavily") gefaßt: "City-data.com crime rate counts serious crimes and violent crime more heavily. It adjusts for the number of visitors and daily workers commuting into cities."Sie bildet nur einen Teil der Verbrechensrate (eigentlich ja: auf den Werten aller erfaßten Verbrechen basierend) ab. --84.191.135.120 18:58, 11. Feb. 2014 (CET)
Ich kann diese Zahl 260 nirgendwo entdecken. Und ob das unpräzise ist oder nicht, spielt für die enzyklopädische Darstellung ja keine Rolle. Wir bilden nur ab und bewerten nicht. LG Stefan 19:26, 11. Feb. 2014 (CET)
Mit dem Mauscursor auf den grünen Balken gehen. --84.191.135.120 19:56, 11. Feb. 2014 (CET)
Jetzt seh ich's, danke! LG Stefan 21:57, 11. Feb. 2014 (CET)

Alternative zum Mittelwert?

Hallo...ich habe folgendes Problem, bei dem mir vor allem Mathe- und Statistikfüchse weiterhelfen können:

Ausgangssituation:

Durch unterschiedliche, komplexe Berechnungsverfahren habe ich mehrere Zahlenwerte die sich auf morgen beziehen. Ich muss mich aber heute für eine Zahl entscheiden. Welche (mathematischen) Alternativen zu einer einfachen Mittelwertberechnung gibt es?

Beispiel:

Ich bin ein Wettershowmoderator und habe 5 Wetterfrösche zu hause die alle die morgige Temperatur voraussagen.

  • Frosch 1 sagt 0°
  • Frosch 2 sagt 7°
  • Frosch 3 sagt 35°
  • Frosch 4 sagt 36°
  • Frosch 5 sagt 37°

Welche möglichkeiten habe ich die Terperatur zu ermitteln die ich in meiner Show voraussage? Der Mittelwert wäre 23°. Vom Gefühl her würde ich aber eher zu einem Wert um die 35° tendieren da Frosch 1 und 2 möglicherweise heute einen schlechten Tag haben. Welche (mathematischen) Möglichkeiten habe ich da?

--ZeugeDerNacht (Diskussion) 21:05, 14. Feb. 2014 (CET)

Median? --Buchling (Diskussion) 21:19, 14. Feb. 2014 (CET)
Danke. Gibts noch andere Methoden und wenn ja wo kann ich die den Nachlesen? ZeugeDerNacht (Diskussion) 21:22, 14. Feb. 2014 (CET)
Mittelwert#Definitionen_der_bekanntesten_und_wichtigsten_Mittelwerte hilft vielleicht? Im konkreten Fall sind sie aber mit ein bißchen Vorsicht zu behandeln, weil bis auf Median und „klassichen“ Mittelwert (Fachbegriff: arithmetisches Mittel) alle durch die relativ willkürliche Festlegung des Nullpunkts der Celsiusskala verzerrt werden … --L47 (Diskussion) 21:49, 14. Feb. 2014 (CET)
Ergänzend kannst du die Genauigkeit oder Zuverlässigkeit des errechneten Mittelwertes anhand des Stichprobenumfanges ermitteln. --Kharon 21:53, 14. Feb. 2014 (CET)
Du kannst Deine Celsiustemperaturen in Kelvintemperaturen umrechnen und dann außer Median und arithmetischem Mittel auch geometrisches und harmonisches Mittel sinnvoll verwenden. Nach Ermitteln des geo. und harm. Mittels dann wieder in die Celsiusskala zurückwandeln. --Rôtkæppchen68 22:02, 14. Feb. 2014 (CET)
Wir haben auch die Kategorie:Mittelwert. Vielleicht findest Du da noch mehr sinnvolle Mittelwerte. --Rôtkæppchen68 22:06, 14. Feb. 2014 (CET)
Vielen dank an Alle!! Ihr habt mir sehr geholfen. ZeugeDerNacht (Diskussion) 22:32, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: USt (Diskussion) 22:34, 14. Feb. 2014 (CET)

Die Mittelwerte unter Mittelwert#Definitionen_der_bekanntesten_und_wichtigsten_Mittelwerte sind noch nicht besonders geeignet, Ausreißer in den Griff zu bekommen, vergl. Ausreißer, Rosenkohl (Diskussion) 15:20, 15. Feb. 2014 (CET)

Bei vielen Wertungen im Sportbereich wird ja einfach erst mal der unterste und der oberste Wert gestrichen und dann die übriggebliebenen verrechnet (wie nennt man diese Methode?). So werden die gröbsten Schnitzer oder Manipulationsversuche wohl unterbunden. --Pustekuchen2014 (Diskussion) 17:48, 15. Feb. 2014 (CET)

Schadet das ständige Entnehmen und wieder Einsetzen der SD-Karte der Digitalkamera und/oder der Speicherkarte?

Hallo Freunde.

Kann mir jemand zu der gestellten Frage kompetent Auskunft geben? Es geht im Wesentlichen darum, ob zum Übertragen der Dateien die SD-Karte entnommen oder doch lieber über USB direkt aus der Digitalkamera gesaugt werden soll. Ich frage mich, ob durch die mechanische "Belastung" an Kamera oder Karte dauerhafte Schäden entstehen könnten? Irgendwie ist mir der richtige Suchsatz für Google nicht eingefallen oder ich bin mal wieder nur zu doof, Google richtig zu benutzen.

Danke für Eure Hilfe.

Freundlichen Gruß Thogru Sprich zu mir! 09:20, 10. Feb. 2014 (CET)

normal sind solche mechanischen Kontakte mindestens auf einige zehntausend Vorgänge ausgelegt... bei Relais sogar Millionen... --Heimschützenzentrum (?) 09:34, 10. Feb. 2014 (CET)
Hier unterhält man sich darüber - und man hat sehr persönliche Präferenzen (nur einer hat mit dem Kartenentnehmen Probleme bekommen, macht es aber weiterhin...)
Die Frage scheint eher zu sein: Was ist für meinen Fall praktischer? (Oder: Wenn ich alle Manipulationen beider Vorgehensweisen aufliste: Wobei habe ich am wenigsten Aufwand?). Ich lasse die Karte immer drin, weil ich das USB-Kabel permanent installiert habe... GEEZER… nil nisi bene 09:39, 10. Feb. 2014 (CET)
Aus eigener Erfahrung sage ich ja. Ich habe eine damals teure 16-GiB-Karte geschrottet, weil beim häufigen Aus- und Einstecken die Gehäusekante links vorne abgebrochen ist, ausgerechnet an der Stelle, wo der Kontakt sitzt, der dem PC die Präsenz einer Karte meldet. Auch eine „Auftragsschweißung“ mit Heißklebepistole hat nicht lang gehalten. --Rôtkæppchen68 09:45, 10. Feb. 2014 (CET)

Kaum ein Kontakt ist für immer und ewig gemacht. Stellt sich die Frage, ob der USB Anschluss dadurch nicht leidet wenn man den ständig ein und aussteckt um die Karte in der Kamera zu lassen. Praktisch ist die Verwendung des USB Anschlusses schon weil bei viele Kameras damit gleich der Akku aufgeladen wird. Nur die Bilder runter saugen genügt aber nicht. Es braucht vielleicht Stunden bis der Akku voll ist. --Netpilots -Φ- 11:09, 10. Feb. 2014 (CET)

Unter Windows 7, 8 und 8.1 ist es nahezu unmöglich, die Bilder mit korrektem Dateinamen und Zeitstempel per USB auf den Rechner zu laden. Immer wird entweder der Zeitstempel oder der Dateiname oder beides vermurkst. Deswegen bin ich dazu übergegangen, die Bilder grundsätzlich per Kartenleser auf den Rechner zu übertragen. --Rôtkæppchen68 11:24, 10. Feb. 2014 (CET)
Das ist jetzt merkwürdig. Damit bin ich sehr pingelig, hatte aber bisher noch kein Problem... GEEZER… nil nisi bene 12:00, 10. Feb. 2014 (CET)
Mir wäre ja der EXIF-Zeitstempel wichtig und der Dateizeitstempel wurscht. Ersteren wird wohl nicht mal Windows vergurken. --Eike (Diskussion) 13:09, 10. Feb. 2014 (CET)

„Steckzyklen“ ist der Fachausdruck und hier gibt es einen groben Überblick dazu. Das, was an Zyklen gefordert ist wird von der Industrie in der Regel unter Laborbedingungen (!) nachgewiesen. Unbedarfte Handhabung im Feld führt in der Regel zu weitaus weniger Steckzyklen, vorsichtiges Handhaben dagegen kann diese Zahl auch deutlich erhöhen. --84.178.17.239 12:18, 10. Feb. 2014 (CET)

wobei bei Billigprodukten sich der Hersteller oft nicht an die vorgeschriebenen Steckzyklen hält. Zu diesen Billigprodukten zählen oft auch USB-Kabeln, die mit teilweise teuren Geräten mitgeliefert werden, z.B. das Ladekabel vom Samsung Galaxy S3 ist dafür bekannt, dass es auch bei vorsichtiger Verwendung oft vorzeitig den Geist aufgibt bzw. der Kontakt so schlecht wird, dass das Laden sehr viel länger dauert als normal (wobei das in dem Fall nicht so schlimm ist, da beim Ladegerät jeder problemlos das Kabel tauschen kann und man ein neues USB-Kabel schon für <1€ bekommt). In der Frage ging es aber um die Steckzyklen bei SD-Karten, nicht bei USB-Kabeln. Da hängt das aber auch vom verwendeten Cardreader ab, manche Cardreader zerkratzen die Kontakte schneller als andere. --MrBurns (Diskussion) 13:27, 10. Feb. 2014 (CET)

Die Abnutzung ist auch bei Speicherkarten das primäre Verschleissmerkmal, habe dafür in der WP aber keine Werte gefunden. Zu beachten ist, dass der Verbrauch an Steckzyklen nicht nur an „Steckern“ auftritt, die sich an Kabeln befinden, oder an den Kontaktflächen der Speicherkarten, sondern auch an den dazu gehörigen „Buchsen“. Prinzipiell lassen sich auch diese Austauschen, der Aufwand ist aber vergleichsweise groß. Bei der Digitalkamera könnte man versuchen, durch abwechselende Nutzung den Verschleiss auf beide Systeme zu verteilen. --84.178.17.239 13:45, 10. Feb. 2014 (CET)

Wobei die "Buchsen" meist deutlich mehr Steckzyklen aushalten als die "Stecker"... --MrBurns (Diskussion) 13:48, 10. Feb. 2014 (CET)
Naja, der typische Stecker, also der männliche Teil, ist oft einfach nur ein runder „Pin“ oder ein flacher „Tab“, der mechanisch lediglich auf Abrasion beansprucht wird. Die typische Buchse dagegen ist durch bewegliche, federelastische Elemente in der Lage, Toleranzen auszugleichn und den für die Dauer der Verbindung nötigen Kontaktdruck aufzubauen und zu halten. Sie ist daher komplexer und gegen grobe Behandlung empfindlicher. Erhöhter Bedarf an Robustheit kann richtig Kosten verursachen und ist ein wesentliches Unterscheidungsmerkmal bei Bauteilen für Profigeräte im Vergleich zu sogenannter „Consumer“ Ware. --84.178.17.239 14:14, 10. Feb. 2014 (CET)
Trotzdem halten die Buchsen meist mehr aus, weil ein Defekt eienr Buchse während der garantierzeit für den Hersteller meist teurer ist, ein neues Kabell kostet so wenig, dass die meisten Besiter die Garantie wegen sowas garn icht in Anspruch nehmen (die meisten eben lieber 1€ oer wnnn man nicht so gut informiert ist halt ein paar €, als dass sie das ganze Gerät einschicken und eventuell Wochen wartet, bis mans zurückbekommt) und wenn doch, muss der Hersteller nur das Kabel tauschen, was ihm auch billiger kommt, als die Buchse zu tauschen, wofür man ev. das Gerät zerlegen muss. Natürlich kommt es auch manchmal vor, dass der Hersteller die Garantieleistung verweigert, weil er behauptet, dass die Abnutzung nicht im normalen Betrieb entstanden ist oder in seinen Garantiebedngungen ev. gleich Abnutzung ausschließt. Aber wenn sowas zu oft passiert, ist das schlecht für den Ruf des Herstellers. --MrBurns (Diskussion) 14:32, 10. Feb. 2014 (CET)
Vielen Dank für die zahlreichen Meinungen. Also scheint es da keine wirklich aussagenkräftige Vorgabe zu geben. Ich werde einfach mal sehen, was sich am EiPätt als tauglichsten erweist im Zusammenspiel mit dem Connection Kit. Dankenden Gruß Thogru Sprich zu mir! 10:22, 12. Feb. 2014 (CET)

Fischtreppenzwang laut EU-Richtlinie

Europäische Staumauer

Im Artikel Helix-Turmfischpass steht: "Gemäß der EU-Wasserrahmenrichtlinie müssen bis 2015 alle europäischen Staumauern mit geeigneten Fischpässen ausgestattet werden." Wie stellt sich die EU eine Fischtreppe vor bei einem Staumäuerchen in der Art wie hier abgebildet? Gibt es auch Fisch-Lifte? --178.195.134.244 13:51, 10. Feb. 2014 (CET)

Muss sich die EU da was vorstellen? Die EU erlässt Richtlinien, für die Umsetzung ist der Betreiber zuständig (bzw. genauer gesagt muss er das Gesetz einhalten, das in seinem Land aufgrund der EU-Richtlinie erstellt wurde). --MrBurns (Diskussion) 13:57, 10. Feb. 2014 (CET)
Da Fische nicht auf Knöpfe drücken können, wird die EU einen Studiengang "Fischlift-Bedienpersonal" fördern. --178.195.134.244 14:04, 10. Feb. 2014 (CET)
Der erste logische Ansatzpunkt wäre: Was steht wirklich (Wort für Wort) in diesen Richtlinien? Hier ein Einstieg... GEEZER… nil nisi bene 14:09, 10. Feb. 2014 (CET)
Es geht doch so super einfach: zwei Fischpaternoster, einer links, der die Fischli nur nach oben transportiert und rechts einer, der sie nach unten bringt. Im übrigen: seit wann ist die EU in der Schweiz zuständig? --46.244.137.9 14:17, 10. Feb. 2014 (CET)
(BK) Ich kann in der Richtlinie keinen Paragraphen, der dies vorschreiben würde, finden. Heißt natürlich nicht, dass es den wirklich nicht gibt, aber welcher Depp macht denn so eine Angabe, ohne den zugehörigen Paragraphen als Quelle anzugeben... PοωερZDiskussion 14:19, 10. Feb. 2014 (CET)
Aha, die artikelanlegende IP hat damals „Laut der "Wirtschafts Woche" vom 15.07.03“ geschrieben, was Benutzer:Fishkop in die heutige Form geändert hat. PοωερZDiskussion 14:25, 10. Feb. 2014 (CET)
Hier ist des Rätsels Lösung: Nicht ALLE Staumauern, sondern nur die in "Schutzgebieten". Wenn es da also keine Wanderfische gibt, sollte das - selbst aus Sicht eines europäischen Wanderbürokraten - nicht nötig sein. GEEZER… nil nisi bene 14:44, 10. Feb. 2014 (CET)
das wird wie im genannten beispiel wohl auch im wesentlichen (oder vielleicht sogar ausschließlich) laufkraftwerke betreffen. diese sind ohne fischtreppe schließlich eine barriere, die lebensräume in große unabhängige teile trennt. eine staumauer wie im bild hier oben steht demgegenüber in der regel dort, wo vorher irgendein tal mit einem mehr oder weniger großen gewässer beginnt. da müssen keine fische hin, weil da vorher in der regel auch schon keine waren. zumindest vom Stausee Mooserboden weiß ich, z.b. dass es da jetzt forellen gibt, von denen aber keiner weiß, wie die dahingekommen sind. man vermutet aussetzungen durch menschenhand. lg, --kulacFragen? 16:45, 10. Feb. 2014 (CET)
Schutzgebiete also. D.h. der Artikel ist falsch? --178.195.134.244 16:46, 10. Feb. 2014 (CET)
Was ist falsch? Was ist richtig? Man könnte "in Gebieten, in denen natürlicherweise etc. etc." o.ä. einfügen. Aber eine Referenz zu einer Verordnung wäre angebracht. GEEZER… nil nisi bene 16:51, 10. Feb. 2014 (CET)
Einen Artikel zu Lösungen haben wir auch: Fischweg Yotwen (Diskussion) 07:29, 11. Feb. 2014 (CET)
Es gibt doch auch Fische in Bergbächen, die bei einer gewaltigen Talsperre in der Art wie abgebildet dann nicht mehr wandern können. --178.195.134.244 15:33, 12. Feb. 2014 (CET)

Erste Volksverdummung

Wann in der Geschichte gab es die erste größere Volksverdummung? Ich meine, lange vor dem Privatfernsehen... --93.133.113.239 20:51, 10. Feb. 2014 (CET)

23 x - und kein Artikel dazu.... GEEZER… nil nisi bene 20:59, 10. Feb. 2014 (CET)
Vermutlich bei der ersten Bildung eines Volkes. Irgenwie muss man ja größere Menschenmassen "koordinieren".--Wikiseidank (Diskussion) 21:01, 10. Feb. 2014 (CET)
Nicht dass ich Christen/Moslems/Juden unter den Lesern hier zu nahe treten möchte, aaaber: The great unmentionable evil at the center of our culture is monotheism. From a barbaric Bronze Age text known as the Old Testament, three anti-human religions have evolved — Judaism, Christianity, Islam. These are sky-god religions. They are, literally, patriarchal — God is the Omnipotent Father — hence the loathing of women for 2,000 years in those countries afflicted by the sky-god and his earthly male delegates. The sky-god is a jealous god, of course. He requires total obedience from everyone on earth, as he is in place not for just one tribe but for all creation. Those who would reject him must be converted or killed for their own good. Ultimately, totalitarianism is the only sort of politics that can truly serve the sky-god's purpose. Gore Vidal (Nicht dass Religion sicherlich schon früher missbraucht wurde...) Solaris3 (Diskussion) 21:05, 10. Feb. 2014 (CET)
Ich sehe den speziellen Zusammenhang zum Monotheismus nicht so sehr. Mit Polytheismus kann man auch noch einen der Götter auf der Erde haben (siehe altes Ägypten) oder eben einen limitierten "Zugang" zur Götterwelt (Schamanen, Priester, Orakel, ...). --mfb (Diskussion) 21:12, 10. Feb. 2014 (CET)
Richtig. Er nimmt ja auch einschränkend Bezug zu unserer heutigen Kultur, daher war das Zitat nicht 100% passend, aber ich konnte nicht widerstehen ;-) Solaris3 (Diskussion) 21:16, 10. Feb. 2014 (CET)
Falls es irgendwie hilft, an anderer Stelle (The Birds and the Bees) führt Vidal weiter aus: Apparently, the first human societies were tribal-extended families. Then the prenuclear family was invented. Skygods were put in place-jealous ones, too. The monotheistic religions from which we continue to suffer are fiercely grounded on the only fact that we can be certain of. Man plus Woman equals Baby. This, for many, is the Natural Law. Inevitably,if unnaturally, natural lawyers thought up marriage and monogamy and then, faced with the actual nature of the male and the female, they created numerous sexual taboos in order to keep the population in line so that the senior partners in the earthly firm could keep the rest of us busy building expensive pyramids to the glory of the Great Lawyer in the Sky. But as a certain Viennese novelist and classics buff, Sigmund (“It’s all in the vagina, dear”) Freud, noted, all those fierce do’s and don’ts have created discontents, not to mention asthma and date rape. In fact, everything that the Book (from which comes Judaism, Christianity, Islam) has to say about sex is wrong. Of course, practically everything the Book has to say about everything else, including real estate, is wrong too […]. --Janneman (Diskussion) 22:40, 10. Feb. 2014 (CET)

Danke. Die Passage ist ja noch viel besser. Solaris3 (Diskussion) 01:34, 11. Feb. 2014 (CET)

Das Christentum als Volksverdummung? Ich wage mal zu behaupten: Hätte es das Christentum nicht gegeben, säßen wir schon seit der Völkerwanderung wieder auf Bäumen. Das Christentum war über Jahrhunderte der einzige Kulturträger und -überlieferer Europas. Selbst die vormals heidnische mohammedanische Welt wurde in ihren Anfängen vom Christentum gleich mitverklugt: übernahm sie doch Story, Schrift(!) und Ackerbau(!!) von den Christen. Hätten die Syrer nicht soviel Nächstenliebe gezeigt, wäre es nie zum langfristigen Aufstieg des Islams gekommen -- mangels Technik und Bildung. Das Judentum als Volksverdummung? Eine Gesellschaft, in der viele, viele Leute lesen und schreiben konnten und man unabhängig von Herkunft und Besitz allein durch Bildung und Intelligenz zu Ansehen kommen konnte, hat es wohl in der Antike kein zweitesmal gegeben. Man sollte die Welt nicht nur mit dem satten, paläophoben Blick von heute sehen, sondern auch ein bißchen die historischen Zusammenhänge im Auge behalten: Von der Höhe der Jetztzeit verächtlich auf die Vergangenheit hinabzublicken, ist ein bißchen zu kurz gedacht: Man steht nämlich drauf. --Hermine Tuzzi (Diskussion) 11:50, 12. Feb. 2014 (CET)
Panem et circenses. --Rôtkæppchen68 21:24, 10. Feb. 2014 (CET)
"BILD dir eine Meinung" --92.196.12.250 00:15, 11. Feb. 2014 (CET)
Der Spruch heißt "BILD dir deine Meinung" und ist deswegen noch viel perfider, weil er gleichzeitig suggeriert, der Leser-Dödel hätte tatsächlich eine eigene Meinung, aber gleichzeitig offen ausspricht, dass die von der BILD bestimmt wird, womit wiederum klar ist dass der Leser gar keine echte eigene Meinung hat. Ein Fnord sozusagen, oder Mindfuck. Dürfte aber etwas jünger als das Alte Testament sein. Solaris3 (Diskussion) 01:34, 11. Feb. 2014 (CET)
Ich hätte noch etwa 2000 v.Chr. anzubieten: Ägyptisches Totenbuch. Um auch flott und problemlos ins Jenseits übergehen zu können, musste der Bürger zu Lebzeiten ein solches aufwendiges Buch anfertigen lassen, wofür er mindestens ein kleines Vermögen zahlte. Solaris3 (Diskussion) 01:45, 11. Feb. 2014 (CET)
Es gibt doch dieses Geflügelte Wort, von dem, der als erstes akzeptiert hat, als ihm jemand anderes gesagt hat, etwas sei sein Besitz. Wie geht das noch mal? Die Situation dürfte aber nicht überliefert sein und auch bei Territorialverhalten von Tieren vorkommen. --Zulu55 (Diskussion) Unwissen 16:07, 11. Feb. 2014 (CET)

bitte rüber ins cafe! (nicht signierter Beitrag von RoNeunzig (Diskussion | Beiträge) 21:47, 11. Feb. 2014 (CET))

Wolfram und Kupfer verlöten

Ich habe hier einen Draht aus Wolfram, den ich an eine Kupferlitze löten will per Pb38Sn60Cu2. Leider funktioniert es nicht. Das Wolfram lässt sich mit dem Lot nicht benetzen. Was kann ich tun? --93.132.160.97 14:32, 11. Feb. 2014 (CET)

Ich weiss nicht, ob Wolfram wie Alu eine Oxydschicht bildet. Alu kann man löten, wenn man das Metall mit Schmirgel bearbeitet und ein leicht flüchtiges Öl aufträgt, damit sich die Oxydschicht nicht neu bildet. Dann mit dem sehr heissen Lötkolben direkt in das Öl löten (stinkt). Zweitens könnte das eine Frage der Galvanotechnik sein. Ich kenne das Problem, dass Eisenwerkstoffe nicht verchromt werden können, weil das chrom schnell wieder abblätternt. Dafür wurde meines Wissens nach erst verkupfert, dann vernickelt und dann konnte Chrom aufgetragen werden (keine Ahnung, ob die Reihenfolge so stimmt). Yotwen (Diskussion) 14:49, 11. Feb. 2014 (CET)
<quetsch>Reihenfolge stimmt. --Rôtkæppchen68 18:13, 11. Feb. 2014 (CET)
Wolfram kann mit Silberlot und Borax-Flussmittel gelötet werden. Siehe: Abschnitt Fügen und Verbinden. Das ist allerdings Hartlöten ein Lötkolben reicht da nicht mehr. --Mauerquadrant (Diskussion) 14:52, 11. Feb. 2014 (CET)
In der Glühlampenfertigung wurde der Glühdraht aus Wolfram immer nur geklemmmt, hier und hier gut zu erkennen. --Rôtkæppchen68 16:17, 11. Feb. 2014 (CET)
Bei den Temperaturen eines Glühdraht dürfte jedes Lot wegschmelzen oder verdampfen, hat eher nichts mit der Frage zu tun ob und wie sich Wolfram löten lässt.--Giftzwerg 88 (Diskussion) 21:29, 11. Feb. 2014 (CET)
An den ungewendelten Enden des Glühdrahts ist die Leistungsdichte wesentlich geringer und die Kühlung durch die Zuleitungsdrühte gegeben, sodass hier eine Schweiß- oder Hartlötverbindung durchaus denkbar ist. --Rôtkæppchen68 22:00, 11. Feb. 2014 (CET)
Da gibt es schöne Bilder von Glühdrähten, auf denen es genau zu erkennen ist, wie sie angebracht wurden. --Hans Haase (有问题吗) 14:14, 12. Feb. 2014 (CET)

CO2 Grenzwerte USA

In diesem Artikel [11] steht, dass Porsche ab 2015 mit einer Strafe von 37.500 EUR pro Fahrzeug rechnen muss, wenn sie ihre CO2 Grenzwerte nicht senken. In Anbetracht der Tatsache, dass der Ford F150 das meistverkaufte Auto in den USA ist, frage ich mich, wie das möglich ist. Alleine das Basismodell hat 4,2 Liter und das Topmodell 6,5 Liter (Hubraum, nicht Verbrauch) und einen CO2 Ausstoß von wahnwitzigen 387 g/km! Sechszylinder sind in den USA so verbreitet wie bei uns 4 Zylinder. Wie passt das alles zusammen? --93.132.160.97 18:51, 11. Feb. 2014 (CET)

Hast du die zweite Seite des Artikels gelesen? Da steht das diese Grenzwerte im Schnitt für die gesamte Flotte eines Konzerns erreicht werden müssen. Das dürfte Ford leicht fallen, da die ja auch kleinere Fahrzeuge haben. --Lidius (Diskussion) 18:58, 11. Feb. 2014 (CET)
Die Regelungen für die CO2 Grenzwerte in den USA haben mit Umweltschutz nichts zu tun. Dort wird der zulässige CO2 Grenzwert nach Radstand (!) berechnet. Ein F150 Pick Up mit einem Verbrauch ähnlich dem eines LKW kann aufgrund seines Radstandes weiter mehrere hundert Gramm CO2 ausstoßen. Ziel der Regelung ist, die deutschen Premiumhersteller, welche nicht solche schwachsinnig überdimensionierten Autos bauen, aus dem Markt zu kicken. --77.3.186.240 19:02, 11. Feb. 2014 (CET)
Siehe Corporate Average Fuel Economy. Solaris3 (Diskussion) 19:04, 11. Feb. 2014 (CET)
Was meine These belegt. Wenn ein Kleinwagenhersteller wie Fiat in den USA CO2 Strafzahlungen leisten muss, aber kein US Hersteller, dann ist das Politik. Eigentlich ein Fall für die WTO. --77.3.186.240 19:07, 11. Feb. 2014 (CET)
Ich bezweifle dass die großartig helfen wird: The basic challenge is that what is called globalization is really another name for the dominant role of the United States. - Henry Kissinger (quelle) Solaris3 (Diskussion) 19:40, 11. Feb. 2014 (CET)
Und ich bezweifle, dass das in diesem Fall überhaupt eine Rolle spielt. Der Käufer eines Ford F150 wird keinen Porsche Cayenne haben wollen und umgekehrt. Und das zusätzliche Geld muss ja der US-Käufer des Cayenne berappen. Zurecht, denn dieses Fahrzeug hat im Gegensatz zu einem Pickup keinen Nutzwert abseits einer Schwanzverlängerung. -- Janka (Diskussion) 21:04, 11. Feb. 2014 (CET)
Du bist also der Ansicht, dass ein F150 wegen seinem Nutzwert das meistverkaufte Auto der USA ist? Und nicht etwa, weil es noch eine viel größere "Schwanzverlängerung" als ein Cayenne ist? Darf ich an der Stelle mal fragen, wozu der Durchschnittsamerikaner so ein [12] 416 PS Benzin (!) -Pickup nützlicherweise braucht? Ein Cayenne wirkt dagegen wie ein Spielzeug. Erst recht gegen einen Dodge RAM [13], welcher selbstverständlich auch nur deswegen in auf den ersten fünf Plätzen der Zulassungsstatistik ist, weil er so zurückhaltend ist und nicht deswegen, weil er so aussieht, dass er täglich drei Cayennes zum Frühstück verspeist? --77.3.186.240 21:48, 11. Feb. 2014 (CET)
Bei besonders großen amerikanischen Autos ist es sogar manchmal so, dass die garnicht für CAFE mitgezählt werden, siehe z.B. en:Ford_Excursion#Fuel_economy. --MrBurns (Diskussion) 00:12, 12. Feb. 2014 (CET)
Schwanzverlängerung sind beide. Mit dem F150 kann man aber zusätzlich den ganzen Haushalt transportieren. Mit dem Cayenne nichtmal einen mittleren Einkauf. -- Janka (Diskussion) 11:11, 12. Feb. 2014 (CET)
Ergänzung: Schön, dass du mir genau bestätigt hat, was ich schrieb: Der Cayenne ist ein Spielzeug. -- Janka (Diskussion) 11:13, 12. Feb. 2014 (CET)
Nur muss man wohl nur sehr selten "den ganzen Haushalt transportieren" und für die paar mal, die man das muss, ist es wohl deutlich ökonomischer, sich einen Kleinlaster auszuleihen, als ständig so einen teuren Spritfresser zu fahren. Es gibt vielleicht einige Farmer/Rancher/Gewerbetreibende, für die solche Autos wirklich sinnvoll sind, aber ich schätze mal, für mindestens 90% aller SUV-/Pickup-Besitzer sind die Dinger wirklich nur eine Schwanzverlängerung. --MrBurns (Diskussion) 13:26, 12. Feb. 2014 (CET)
Sogar um regelmäßig Leute und Gerät ins Gelände zu bringen sind kleinere Pickups oft sinnvoller. Mir wurde von meiner Firma zu diesem Zweck auch mal so ein Riesenteil überlassen (ich glaube, es war irgendso ein fetter Ford). Gaja-sei-dank, nur für kurze Zeit, denn das war ausgesprochen unpraktisch. Wenn man irgendwo im Gebirge auf einer anderhalbspurigen Serpentinenpiste rumkrabbelt, dann findet man bei (seltenem aber möglichen) Gegenverkehr vielleicht noch irgendwo eine Haltebucht, wo man sich aneinder vorbeiquetschen kann, aber wenn die Piste z.B. durch Steinschlag, oder so, versperrt ist, dann kommt man tüchtig ins Schwitzen, wenn man da mit so einem Hulk wenden will, oder die zehn Kilometer Serpentinen im Rückwärtsgang wieder runter muss... Geoz (Diskussion) 14:08, 12. Feb. 2014 (CET)

Wenn ich das richtig verstanden habe, ist der neueste Nicht-Porsche (umgelabelter Audi Q5) auch rechtlich eigentlich ein Audi um die alte Zulassung weiternutzen zu können. Man wird schon einen Weg finden, bis in drei Jahren alle US-Porsches formal als VW zulassen zu können. Wäre vor dem Hintergrund der Plattform-Strategie bei VW ja sonst auch besonders absurd: Für das praktisch identische Auto mal eine hohe Strafe und mal keine je nachdem ob ab Ende ein Porsche-, Audi-, VW- oder bis dahin sicher auch Skoda-Logo draufgepappt wird... --Studmult (Diskussion) 21:42, 11. Feb. 2014 (CET)

Der Cajun ist kein umgelabelter Audi Q5, sondern eine Parallelentwicklung. Gewisse Teile sind bei Cajun und Q5 identisch, gewisse andere Teile wurden speziell für Cajun und Q5 parallel entwickelt. Bei Cayenne, Touareg und Q7 war es genauso. --Rôtkæppchen68 12:53, 12. Feb. 2014 (CET)

Wo landet eigentlich die Asche unserer Kohlekraftwerke?

Das müssen ja gigantische Mengen sein. Der Artikel sagt nur: "Die Asche des Brennstoffes wird als Schlacke aus dem Brennerraum abgezogen und für die Weiterverwendung als Baustoff vorbereitet." Wer weiss Genaueres und warum macht man das in Teilen der USA offenbar nicht, sondern leitet sie, böse gesagt, nach Drittweltmanier in den Fluss? Deponien sind inzwischen in Deutschland verboten, dachte ich, gilt das auch für die Großindustrie? Und wo landet eigentlich die Schlacke, die bei der Haumüllverbrennung entsteht? --92.202.6.119 22:38, 11. Feb. 2014 (CET)

Straßenbau, Sondermülldeponie (nicht signierter Beitrag von 84.143.223.196 (Diskussion) 22:39, 11. Feb. 2014 (CET))
Kohle - keine Ahnung. Müllverbrennung - leider nur alte Zahlen von 2003: Da sind bei uns (i.e. in Bayern) 2 Mio. Tonnen Müll verbrannt worden, das ergab 565.000 Tonnen Asche. 50.000 Tonnen davon waren Metalle, die in die Wiederverwertung gingen. 405.000 Tonnen wurden zu Baustoff, 110.000 Tonnen kamen auf eine Deponie. --Rudolph Buch (Diskussion) 23:22, 11. Feb. 2014 (CET)
Deponien sind, anders als es der Fragesteller denkt, nicht verboten. Es ist lediglich verboten unbehandelten Hausmüll auf eine Deponie zu kippen. Nachdem er z.B. eine Müllverbrennungsanlage durchlaufen hat, ist eine Deponierung allerdings erlaubt.--79.238.48.67 11:02, 12. Feb. 2014 (CET)
Kann man die Kohlenasche nicht als Dünger ausbringen? Oder ist die anders zusammengesetzt als die gewöhnliche Holz- und Koksasche aus dem Ofen? --Hermine Tuzzi (Diskussion) 12:01, 12. Feb. 2014 (CET)
Die Asche enthält giftige und radioaktive Verbrennungsprodukte wie polyzyklische aromatische Kohlenwasserstoffe, Dioxin, Schwermetalle inkl. Uran etc. Das will niemand auf dem Acker haben. Wenn der Schadstoffgehalt gering ist, geht das Zeug in den Straßenbau als Zuschlagstoff zur sog. Gesteinskörnung, bei höherer Belastung auf die Deponie. --Rôtkæppchen68 12:41, 12. Feb. 2014 (CET)
So weit mir bekannt wird das Zeug eben wegen der Schadstoffbelastung zunehmend weniger im Straßenbau eingesetzt - zum Leidwesen der Betriebe bei denen das anfällt, weil die es nicht mehr loswerden.--Antemister (Diskussion) 13:34, 12. Feb. 2014 (CET)

Bisschen Literatur: [14] (Österreich), [15] (Kapitel 4), [16], [17]. --тнояsтеn 15:09, 12. Feb. 2014 (CET)

Lithium Polymer Akku

Sind die besser als Li Ion Akkus? Teurer sind sie jedenfalls. 2001:4C28:4000:721:185:26:182:25 22:52, 11. Feb. 2014 (CET)

ja, die sind besser. Vor allem haben sie mehr Kapazität und einen geringeren Memory-Effekt, also die Kapazität nimmt über einen wiederholten Lade- und Entlade-Zyklus nicht so schnell ab. --El bes (Diskussion) 23:06, 11. Feb. 2014 (CET)
Können aber bei unsachgemäßer Handhabung leichter explodieren. 213.54.7.243 23:09, 11. Feb. 2014 (CET)
Auch wenn man sie normal ins Handy legt?2001:4C28:4000:721:185:26:182:25 23:15, 11. Feb. 2014 (CET)
Je billiger, desto Wumm! Es kann aber auch bei Markenakkus gelegentlich zu Feuer oder Explosion kommen. Aber wenigstens rufen die Markenhersteller ihre Akkus dann zurück. Den chinesischen Billigproduzenten ist das egal. --Rôtkæppchen68 23:56, 11. Feb. 2014 (CET)
Neben bei ein Lithium-Polymer-Akkumulator ist eine Bauform des Lithium-Ionen-Akkumulators. --Mauerquadrant (Diskussion) 02:00, 12. Feb. 2014 (CET)

internetmarke

Ich habe hier noch eine Reihe 58 Cent Internetmarken der deutschen Post rumliegen. Inzwischen beträgt das Porto für einen Standardbrief ja 60 Cent. In den AGB zu den Internetmarken steht, dass diese nicht kombiniert werden dürfen, weder mit normalen Briefmarken, noch mit anderen Internetmarken. Was mache ich jetzt? --77.3.186.240 23:19, 11. Feb. 2014 (CET)

Internetmarke#Nutzung, vorletzter Absatz. XenonX3 – () 23:21, 11. Feb. 2014 (CET)
Vielleicht fällt das gar nicht auf, wenn Du sie losschickst. Internetmarken werden anscheinend kaum oder gar nicht von den Sortier-/Stempelmaschinen erkannt. Die werden sehr oft wie Briefmarken abgestempelt, ich habe schon komplett verschlossene Warensendungen mit Internetmarke und dem Vermerk Warensendung bekommen usw. Einmal habe ich zwei Sachen bei ebay verkauft und dem jeweils falschen Empfänger geschickt. Die haben dann die Sachen zurückgeschickt, wobei der eine einfach den Umschlag mit der (meiner) Internetmarke und überklebter Adresse nochmal verwendet hat. Auch die ist ohne Beanstandung zurückgekommen. --91.0.189.41 23:33, 11. Feb. 2014 (CET)
Normale Briefmarken fluoreszieren. Daran erkennt die Stempel- und Sortiermaschine die Position der Marke und die Seite, auf der die hoffentlich maschinenlesbare Anschrift ist. Um eine Internetmarke zuverlässig zu erkennen, müsste der Brief erst von beiden Seiten fotografiert werden. Eine Fluoreszenzerkennung geht wesentlich einfacher. --Rôtkæppchen68 08:53, 12. Feb. 2014 (CET)
Ist das was ihr hier macht eigentlich Öffentliche Aufforderung zu Straftaten? --195.36.120.125 10:15, 12. Feb. 2014 (CET)
Nö. Der Aufforderungscharakter fehlt. Außerdem bezweifle ich, dass wegen einer Summe von 58 cent ein (Zivil-)Verfahren geführt würde. Einen Artikel zu Postbetrug haben wir leider nicht, aber: Was ist die unsachgemäße Verwendung eines Postwertzeichens gegen die Gründung eines Postmonopolisten? Richtig, nichts.-- Alt 11:21, 12. Feb. 2014 (CET)

Mailling lists in der Vergangenheit?

Gab es nach der Erfindung des Buchdrucks eigentlich auch Bestrebungen, regelmäßige Flugblätter herauszugeben, in denen einzelne Leute Beiträge an alle publizieren können? --188.100.185.216 00:40, 12. Feb. 2014 (CET)

Klar so was nennt man Zeitung. Siehe: Geschichte der Zeitung. --Mauerquadrant (Diskussion) 01:33, 12. Feb. 2014 (CET)
Zeitschriften nicht zu vergessen, siehe auch Pressegeschichte in Deutschland. --Neitram  09:44, 12. Feb. 2014 (CET)
Elektronische Flugblätter --91.0.178.22 09:45, 12. Feb. 2014 (CET)

Einschreiben mit Rückschein

bei einem Einschreiben mit Rückschein steht der Absender ja auf dem Rückschein drauf (Kartenrückseite) muss ich zusätzlich den Absender noch auf den Brief schreiben?

--78.48.137.78 00:47, 12. Feb. 2014 (CET)

ja. --El bes (Diskussion) 00:50, 12. Feb. 2014 (CET)

Avicii Konzert Dauer???

Hallo, bin heute Abend auf einem Avicii Konzert mit meiner Freundin, das fängt um 20:00 Uhr an, die Frage ist wo erfahre ich wann das Konzert etwa zu Ende ist=??--08:57, 12. Feb. 2014 (CET) (ohne Name signierter Beitrag von 84.162.223.170 (Diskussion))

Eigentlich wollte ich schon schreiben, dass man sowas vorher nie weiß, aber hier steht es sogar, mit Hinweisen zum Jugendschutz... Also, es geht bis 23 Uhr, und theoretisch müsstet ihr mindestens 16 sein, um ohne Begleitung eines Erwachsenen so lang zu bleiben. Ob die das dann auch durchsetzen, weiß man nicht. --Eike (Diskussion) 09:30, 12. Feb. 2014 (CET)
Ich würde das eher als Richtwert sehen, auch der selbe Künstler kann bei unterschiedlichen Konzernten selbst während der selben Tour unterschieldich lang spielen, vor allem wegen unterschiedlich langen Zugaben. Außerdem gibt es manchmal Verspätungen von Künstlern oder technische Probleme, die bewirken können, dass ein Konzert länger dauert. Laut dem Jugendschutzhinweis sollte es aber wohl spätestens um 24:00 zuende sein. --MrBurns (Diskussion) 13:20, 12. Feb. 2014 (CET)

Windows-Versionen

>Sehr Geehrte Damen u.Herren! Ich besitze einen Computer XP.Kann ich auch Windows 7 darauf laden? Dieses System wird ja bald nicht mehr gewartet Oder Brauche ich Einen neuen Computer?

 mit freundlichen Grüssen H. Vahlensieck.

--93.202.108.68 11:02, 12. Feb. 2014 (CET)

Am besten Sie tun gar nichts und freuen sich noch viele Jahre über Ihren alten Computer. --El bes (Diskussion) 11:10, 12. Feb. 2014 (CET)
Den Rechner behalten gerne, nichts tun bitte nicht. Niemand möchte seine Wertsachen in einer Ruine aufbewahren, Wachdienst hin oder her. Und selbst wenn Sie nichts zu verlieren haben: Sie wollen auch nicht, dass Terroristen aus Ihrem Haus auf die Nachbarschaft feuern. --Eike (Diskussion) 11:29, 12. Feb. 2014 (CET)
Nein, du brauchst keinen neuen Computer. Die Lizenzen für neuere Windows-Versionen sind im Handel erhältlich (meist um die 100 Euro). Das kannst du dann einfach installieren. Ich würde aber empfehlen, vorher zu prüfen, welche Systemanforderugen dein Wunschprodukt hat und das mit dem Rechner abgleichen. Schließlich soll es ja funktionieren. --78.52.36.18 11:11, 12. Feb. 2014 (CET) PS: Ich habe die Überschrift mal ersetzt.
Das wird vermutlich nicht funzen, weil es für Windows 7 viele Treiber nicht mehr gibt, die die alte Hardware benötigt. War auch früher schon so. -- Janka (Diskussion) 11:18, 12. Feb. 2014 (CET)
Im Gegensatz zu Vista hat Windows 7 32 Bit wenig Probleme mit Windows-XP-Treibern. TV-Karten mit WDM-Treibern laufen nicht mehr unter Vista und folgende. Meine alte ISDN-Karte mit Windows-2000-Treibern, die auch auf XP liefen, musste weg. Der Scanner, der mit Vista nicht funktionierte, funktionierte mit Windows 7 x86 wieder. --Rôtkæppchen68 11:28, 12. Feb. 2014 (CET)
Das kann man so nicht allgemein sagen. Ein Computer mit XP könnte ja ein 10 Jahre altes Gerät mit Celeron-CPU sein oder auch ein fast neues Gerät, auf dem ein Computerfreak XP installiert hat. Man müsste die Art der CPU, Hauptspeicher- und Festplattengröße wissen.--Optimum (Diskussion) 11:30, 12. Feb. 2014 (CET)
Die Frage hatten wir neulich schonmal, und die Antworten waren ähnlich gegensätzlich. Wollt ihr den armen Mann/Frau wirklich so verwirren? Vielleicht könnte man sich zukünftig auf eine Linie einigen - zB fragen, was es denn eigentlich für eine Hardware ist, und dann erst Empfehlungen aussprechen? Solaris3 (Diskussion)
Richtig, allerdings sind viele Anwender schon damit überfordert die Hardware genau zu beschreiben. Man müste dem Fragensteller also schon genau sagen wie er seine Konfiguration ermitteln kann. Ich kenne mich mit Windows (zum Glück) nicht aus, da ich nur Linux benutze. Dort gibt es einen einfachen Befehl der eine Liste der Harware ausspuckt. Gibt es eine einfache Möglichkeit unter XP so eine Liste zu erzeugen? Diese könnte der Fragesteller dann hier Einstellen und die Windows-Fachleute könnte eine eindeutige Antwort geben. Gruss--Degmetpa (Diskussion) 12:09, 12. Feb. 2014 (CET)
Der Windows 7 Upgrade Advisor kann auch von Laien bedient werden. Er gibt detailliert Auskunft, ob die Hardware und Software Windows-7-tauglich ist. --Rôtkæppchen68 12:27, 12. Feb. 2014 (CET)
Vielleicht kriegen wir ja wirklich was zusammengetragen (falls die Fragesteller hie rüberhaupt je wieder vorbeischauen). Hier ist der Advisor für XP -> Windows 8 verlinkt: http://windows.microsoft.com/en-us/windows-8/upgrade-from-windows-vista-xp-tutorial --Eike (Diskussion) 12:33, 12. Feb. 2014 (CET)
+1. Möglicherweise sind die Antworten für den Fragesteller schon jetzt unbrauchbar (weil zu kompliziert), wenn er sein Gerät z.B. nur zum Schreiben von Briefen und Email benutzt und sonst kein besonderes Interesse an Technik hat. Vor kurzem wurden dann hier aber sämtliche Fremdwörter und Abkürzungen aufgezählt, die irgendwie im Zusammenhang mit Computertechnik stehen und der Abschnitt geriet zwischen die Fronten der Linux- und der Windowsverteidiger. Wenig zielführend.--Optimum (Diskussion) 12:13, 12. Feb. 2014 (CET)
 ? Ich will keine Linux Debatte Losbrechen und auch keine Übersetzungsliste für Computerfremdwörter. Ich frage nur, ob es für den Herrn hier eine einfache Möglichkeit gibt, unter Win XP seine Hardwarekomponenten zu erfragen und diese Komponenten dann hier zu posten. Sorry wenn ich mich undeutlich ausgedrückt habe. Viele Grüße--Degmetpa (Diskussion) 12:28, 12. Feb. 2014 (CET)
<quetsch> Ebenfalls sorry, Du warst gar nicht gemeint :) Als ich zu schreiben anfing, war Dein Beitrag noch gar nicht da.--Optimum (Diskussion) 13:07, 12. Feb. 2014 (CET)
(BK) Obwohl ich ein Männchen bin, weiß ich, dass es Tampons gibt. Ist das jetzt "Pech"? Ist es "Glück", keine Ahnung vom Supermarkt-Betriebssystem zu haben? In der Senioren-Arbeit (aber meine "Kunden" haben auch genügend Geld, sich für meine Kurse anzumelden) zeigt sich mehr und mehr der Trend, dass man zum nächsten Händler (der PC-Fachmarkt mit "A" am Anfang und "ldi" am Ende oder alles andere, was sich gerade in der Nähe findet) geht und sich ein neues Gerät kauft. Einschalten - fertig. Die Angst, Daten bei der Neu-Installation zu vernichten entfällt, da das alte Gerät weiterhin - wenn auch offline - existiert. Nach einigen Wochen wird es dann in der Familie dem nächsten Bastler in die Hand gedrückt. Das neue Gerät läuft idR besser und schneller... Eine stressfreie (aber um Faktor 3 teurere) Lösung... Eine erste Orientierung über die verbaute Hardware bietet übrigens der Griff zur Tastenkombination "Windows-Taste" (unten links; festhalten) und "Pause-Taste" (oben rechts, zusätzlich antippen) - die damit generierten System-Informationen geben zumindest Auskunft über Geschwindigkeit und Arbeitsspeicher des Systems... Bu63 (Diskussion) 12:35, 12. Feb. 2014 (CET)
Ok, ich ändere meine Aussage in "zum Glück für mich"--Degmetpa (Diskussion) 12:42, 12. Feb. 2014 (CET)
Na bitte, das sind doch schon mal gute Infos: Windows-Taste und Pause-Taste zeigt Betriebssystem, Prozessor, Arbeitsspeicher und Systemtyp. Oder den Windows 7 Upgrade Advisor laden und starten, bzw. "Wie rüstet man auf Windows 8 auf?". Das sollte man in einem Balken zusammenfassen, ähnlich wie der Rechtshinweis, und danach können alle nach Herzenslust darlegen, warum Mint/Ubuntu/Mac eigentlich viel besser ist.--Optimum (Diskussion) 13:22, 12. Feb. 2014 (CET)
Sehr gute Idee. Da hätte die Diskussion hier wirklich einen bleibenden Wert. ! (und zu "darlegen warum Mac und Linux besser sind": Verstehe ich nicht. Warum was Darlegen was eh jeder weiß ? ;-))--Degmetpa (Diskussion) 15:30, 12. Feb. 2014 (CET)
PS: war nur'n Scherz, Bitte nicht drauf eingehen liebe Windows - Comunity --Degmetpa (Diskussion) 15:35, 12. Feb. 2014 (CET)

"Parteimitgliedschaften" in den USA

Hallo; gibt es in den USA eigentlich für Otto-Normal-Amerikaner eine richtige Parteimitgliedschaft in den großen Parteien so wie in Deutschland? Ist das mit einer Mitgliedschaft in beispielsweise CDU oder SPD vergleichbar (ich kenne das selbst, da finden ja viele Treffen und Veranstaltungen statt)? Ich habe mal was von registrierten Wählern von Dem. oder Rep. gehört, aber ist das mit Mitgliedschaften vergleichbar? MFG --78.52.36.18 11:09, 12. Feb. 2014 (CET)

parteien in usa funktionieren "etwas" anders als hier und haben auch andere aufgaben, aber hier haben wir was zu dem thema: Politisches System der Vereinigten Staaten#Parteien und Verbände im amerikanischen System Elvis untot (Diskussion) 12:02, 12. Feb. 2014 (CET)

Pierre Malbet - Kunst Tischler zz Luis XV

Ich kann keinerlei Information über diesen Herrn im Internet finden. Kann jemand helfen? Ich habe ein altes Sofa genauer untersucht und den stemplel MALBET entdeckt - alles was ich bis jetzt gefunden habe sind Malbet Möbel Stücke die auf antike Händler Webseiten zum Verkauf angeboten werden. (Sothebys,Christies..etc)

--41.135.47.100 11:37, 12. Feb. 2014 (CET)

Pierre Malbet, reçu Maître en 1763. « Il a laissé des sièges charmants, d’une grâce extrême, finement sculptés, (….) dont les proportions sont des plus heureuses (…) », Jean Nicolay, « L’Art et la manière des Maîtres Ebénistes Français au XVIII° siècle », Guy le Prat, Paris, 1955. Das Schulfranzösisch 'rauskramen... ;-) GEEZER… nil nisi bene 13:09, 12. Feb. 2014 (CET)
Und einer aus der Trickkiste: Du suchst "Pierre Malbet" und "1763" (und andere Jahre). Damit findest du (a) weitere Ref. und (b) bekommst ein Gefühl für seine Schaffensperiode. GEEZER… nil nisi bene 13:11, 12. Feb. 2014 (CET)
... und Google => "Pierre Malbet" "maître ebeniste" <= :-) GEEZER… nil nisi bene 13:14, 12. Feb. 2014 (CET)

Vielen dank ! Hab alle Versionen schon versucht und nur die oben genannten Web Seiten gefunden. Kann nicht französisch ....was sagt der gute Jean Nicolay? Wäre schön herauszufinden wann und wo er geboren ist. Gruß aus Kapstadt

Mach mal'n Foto von dem Stempel und lade hoch.
"Malbets Karriere war nur von kurzer Dauer. 1773 musste sein Geschäft in der Rue de Charenton Konkurs anmelden. In seiner kurzen Schaffenszeit fertigte er eine grosse Anzahl an Louis XV- und Transition-Möbeln. Er schuf überwiegend einfache und klassische Modelle von hoher Qualität. Lit.: P. Kjellberg, Le mobilier français du XVIIIe siècle, Paris 1998; S. 543 (biogr. Angaben). GEEZER… nil nisi bene 13:44, 12. Feb. 2014 (CET)
Er hat immer mit "P. Malbet" oder "P. Malbet JME" gestempelt. Hier etwas zum JME. GEEZERte … nil nisi bene 13:54, 12. Feb. 2014 (CET)

Ist leider beim Restaurateur fast abgeschliffen worden. Weiß nur dass man früher ALBET lesen konnte und ganz schwach das M. Ob da ein P war ist nicht mehr möglich festzustellen. Vielen dank für die Hilfe,jetzt weiß ich ein wenig mehr! (nicht signierter Beitrag von 41.135.47.100 (Diskussion) 15:44, 12. Feb. 2014 (CET))

Küchenchemie der Cola

Moin, vor Jahren habe ich in Argentinien ein Messer gekauft, dass nicht nur einen hervorragenden "Biss" beim Fleischschneiden hat, sondern auch einen erheblichen emotionalen Wert. Leider rostet es sehr leicht. Jetzt habe ich den alten Hausfrauentrick angewandt, die Klinge in ein Cola-Getränk zu stellen, um den Rost zu entfernen, bzw. das Abrubbeln desselben mit dem Tintenteil eines Radiergummis zu erleichtern. Das funktioniert gut, wenn auch nicht ganz so schnell, wie erhofft. Offenbar ist es die Phosphorsäure, die den Rost in Wasser und wasserunlösliches Eisen(III)-phosphat umwandelt, und tatsächlich wurde auf dem Grund des Glases eine hellbraune Substanz ausgefällt. So weit, so klar. Allerdings hat sich auch die Cola selbst verändert. Aus der ursprünglich klaren, rötlichbraunen Zuckercouleurfarbe ist ein milchiges Graubraun geworden. Ist da was emulgiert, und wenn ja, was? Geoz (Diskussion) 13:48, 12. Feb. 2014 (CET)

wegen der geheimen Zusammensetzung kann man das wohl nich sagen... oda? --Heimschützenzentrum (?) 14:16, 12. Feb. 2014 (CET)
Karminsäure
TF: Als CC-Inhaltsstoff wird Karmin diskutiert. Solche Substanzen können mit Metallionen zu Farblacken ausfallen, d.h. der lösliche Farbstoff fällt dann weg. GEEZER… nil nisi bene 14:19, 12. Feb. 2014 (CET)
Es war nicht CC, sondern der große Konkurrent mit dem P (aber ich will hier ja keine Werbung machen). Dessen Rezeptur ist aber wohl auch geheim? Geoz (Diskussion) 14:26, 12. Feb. 2014 (CET)
Ja offiziell und nein, denn es wurde geleakt und ist im Zeitalter der Gaschromatographie nicht ernsthaft geheim zuhalten. Siehe Auskunftsarchiv oder WWW-Suche. --Hans Haase (有问题吗) 14:48, 12. Feb. 2014 (CET)
Oh, Michael-Jackson-Fan !
TF II : Könnte auch pH-Effekt sein. Hast du Drano oder so im Haus? Was passiert an der Eintropfstelle von Drano in Cola ? GEEZER… nil nisi bene 14:53, 12. Feb. 2014 (CET) P.S. Dann aber nicht mehr trinken...
Tz tz, immer dieser Markenfimmel... Aber mein No-Name-Natriumhydroxid-Rohrreiniger ist gerade alle (gleich auf die Einkaufsliste gesetzt). Was für eine Reaktion würdest Du denn erwarten? Geoz (Diskussion) 15:24, 12. Feb. 2014 (CET)
Die Plörre mit dem P enthält Sulfit-Zuckerkulör als Farbstoff. Ich kann mir allerhöchstens vorstellen, dass der durch die Phosphatfällung mitgefällt wurde, ähnlich wie im Klärwerk (Phosphorelimination), wo die Phosphatfällung auch mehr als nur Eisenphosphat fällt. --Rôtkæppchen68 15:34, 12. Feb. 2014 (CET)

10 : 3

Algebra: 10 : 3 = 3,3333....(unendlich).

Geometrie: Wenn ich eine Linie A - B von 10 cm Länge zeichne, eine weitere Linie A - C von 9 cm winkelig anbinde und durch 3 teile, B und C verbinde und mit weiteren parallelen Linien teile, ergibt sich eine (endliche) glatte 3-Teilung der 10.

Wer kann mir den Unterschied (für einen Laien) erklären? --79.225.103.177 22:29, 10. Feb. 2014 (CET)

10/3 ist eine endliche Zahl (insbesondere: zwischen 3 und 4), sie besitzt nur im Dezimalsystem keine Darstellung mit endlich vielen Ziffern. Im Dreiersystem hat die Zahl eine solche Darstellung, dort ist die Zahl einfach "10,1". --mfb (Diskussion) 22:34, 10. Feb. 2014 (CET)
Es heißt Strecken. Mit dem von Dir beschriebenen Verfahren mit Maßstabslineal kannst Du beliebige Strecken in beliebig viele gleiche Teile teilen. Wenn Du bei der Division durch ganze Zahlen eine abbrechende Stellenwertdarstellung willst, darf der Divisor keine Primfaktoren enthalten, die nicht auch in der Basis Deines Stellenwertsystems enthalten sind. Im Dezimalsystem heißt das, dass Du problemlos durch z.B. 1, 2, 4, 5, 8, 10, 16, 20, 25, 32,… teilen kannst. Bei allen anderen Zahlen (3, 6, 7, 9, 11, 12, 13, 14, 15, 17,…) bekommst Du nichtabrechende Dezimalzahlen. In anderen Basen ist das genauso. --Rôtkæppchen68 23:01, 10. Feb. 2014 (CET)
Ich verstehe schon: Auch im Dezimalsystem kann ich das Ergebnis endlich darstellen, nämlich 3,(Überstrich)3. Aber während ich geometrisch einen Teilungspunkt exakt darstellen kann, kann ich mich algebraisch diesem Punkt eben nur immer weiter annähern, ohne ihn exakt bestimmen zu können. Wie konnte dann Einstein seine Punkte rechnerisch immer so genau darstellen? Der Schlingel... --79.225.103.177 23:24, 10. Feb. 2014 (CET)
Ich nehme an, dass Albert Einstein sein Lieblingszitat von Carl Friedrich Gauß an die Wand gehängt hatte. --Rôtkæppchen68 23:39, 10. Feb. 2014 (CET)
[Nach BK] Auch algebraisch ist „10:3“, „1/3“ oder „0,333333333…“ exakt bestimmt (im Gegensatz bsplsw. zu π). Daß es sich in einer dieser Notationen um eine periodische Zahl handelt, ändert daran nichts. Das liegt nur daran – wie Rôtkæppchen68 oben richtig erklärt hat –, daß drei der Basis des Dezimalsystemes teilerfremd ist. Alle rationalen Zahlen sind auf diese Weise exakt bestimmt. -- M.ottenbruch ¿⇔! RM 13:26, 11. Feb. 2014 (CET)
[Nochmal BK] Du kannst den Punkt, wie mfb sagte, auch algebraisch ohne "Annäherung" "ganz genau bestimmen", wenn du etwa das Ternärsystem statt das Dezimalsystem für deine Algebra benutzt. Du teilst 1013 durch 103 und erhältst 10,13. --Neitram  13:32, 11. Feb. 2014 (CET)
ich versteh 's noch nich ganz: 1. man kann doch auch nich auf 1000-Stellen genau zeichnen... 2. die Kreiszahl π kann man auch weder aufschreiben (egal welche Basis die Zahldarstellung hat... außer die Basis darf auch unnatürlich sein... *kicher*) noch zeichnerisch exakt hinmalen (son tollen Zirkel gibt's gar nich... --Heimschützenzentrum (?) 08:50, 11. Feb. 2014 (CET)
Ich kann auch jede rationale Zahl exakt als Bruch darstellen, in diesem Fall . Es ist lediglich eine Eigenschaft des Dezimalsystems (das nur eine von vielen möglichen Zahlendarstellungen ist), dass man nicht mit endlich vielen Stellen auskommt. --Pwjg (Diskussion) 12:55, 11. Feb. 2014 (CET)
Die Wurzel aus 2 kann man in keinem Stellenwertsystem exakt darstellen, aber wohl exakt hinmalen. Die beiden Begriffe haben ebennichts miteinander zu tun, wir malen nicht eine Stelle nach der anderen--Alexmagnus Fragen? 13:34, 11. Feb. 2014 (CET)
Nein, kannst du natürlich nicht. Du kannst vermutlich nicht mal auf den Mikrometer genau malen. Ich kann's jedenfalls nicht. Man sieht da halt nur nicht, wie groß der Fehler ist. Dadurch verschwindet er aber nicht. --Eike (Diskussion) 08:03, 12. Feb. 2014 (CET)
Selbstverständlich kann man's hinmalen. Zwei Strecken, an jede die Zahl 1 dran, dazwischen das Symbol für den rechten Winkel. Schon hast du eine Darstellung für die Zahl Wurzel aus 2, ohne dass du die Wurzel allgemein definieren musst. -- Janka (Diskussion) 13:22, 12. Feb. 2014 (CET)
Schleicht sich dann nicht zwangsläufig der Fehler ein, dass man die zwei Strecken nicht exakt gleich lang hinbekommt? —[ˈjøːˌmaˑ] 15:02, 12. Feb. 2014 (CET)
Dann so: Gerade zeichnen, Punkt auf der Gerade markieren, Lot im Punkt errichten, Kreis um Punkt schlagen, zwei benachbarte Schnittpunkte der beiden Geraden verbinden, fertig. Das Verhältnis zwischen der Sehne und dem Radius des Kreises ist . --Rôtkæppchen68 16:21, 12. Feb. 2014 (CET)
Und wenn du dabei Purzelbäume schlägst - du kannst nicht auf 30 Stellen hinterm Komma genau zeichnen. --Eike (Diskussion) 16:40, 12. Feb. 2014 (CET)
Beliebig genau rechnen geht auch nicht, weil irgendwann alle Partikel des Universums zur Herstellung der Rechenregister verwendet werden müssen. Das wäre sehr destruktiv. --Rôtkæppchen68 18:05, 12. Feb. 2014 (CET)
Ging es in der Frage nicht gerade darum, dass man den Term 10/3 nicht darstellen könne? Genau das wurde doch mit Beispielen widerlegt. Und selbst mit irrationalen Zahlen ist das der Fall, es kommt halt bloß darauf an, welche Hilfsmittel man zur Darstellung verwendet. -- Janka (Diskussion) 19:29, 12. Feb. 2014 (CET)
Das kann ich in der Frage nicht finden. Bei Homer ging es um "exakt hinmalen", das ist ja ein ziemlich Unterschied zu "nicht darstellen". --Eike (Diskussion) 21:26, 12. Feb. 2014 (CET)

Nordkoreanische Sportergebnisse

Hallo, stimmt das, dass das den Nordkoeranischen Medien übertragen wurde? Oder ist das ein Fake? Existiert für die Nordkoreaner noch die UDSSR? http://9gag.com/gag/aVOZLyM --GroßerHund (Diskussion) 10:56, 12. Feb. 2014 (CET)

Nein, ja, nein. --Komischn (Diskussion) 11:10, 12. Feb. 2014 (CET)
(BK) Da in der Adresse des von dir angegebenen Links zwei mal das Wort "gag" vorkommt, könntest du eigentlich selber auf die Antwort kommen. Nordkorea ist zwar nicht gerade das große Vorbild in Sachen Pressefreiheit, aber so blöd sind sie dort dann auch wieder nicht. --79.238.48.67 11:13, 12. Feb. 2014 (CET)
Naja nicht alles was auf 9Gag ist ist ein Fake und Nordkorea traue ich alles zu ^^ trotzdem danke. GroßerHund (Diskussion) 11:20, 12. Feb. 2014 (CET)
Das kann nicht stimmen, denn Fahne (China VolksrepublikVolksrepublik China Volksrepublik China VR China) und Bezeichnung (TaiwanRepublik China (Taiwan) Taiwan Taiwan) des dritten Platzes passen nicht zusammen. --Rôtkæppchen68 11:32, 12. Feb. 2014 (CET)
So weit mir bekannt greift diese Witzchen eine wahre Gegebenheit auf, nämlich die dass bei der Berichterstattung über internationele Sportereignisse in Nordkorea feindlich gesonnene Staaten schlicht ignoriert werden.--Antemister (Diskussion) 13:34, 12. Feb. 2014 (CET)
Zum Thema "Sport in den nordkoreanischen Medien" auch interessant: [18], [19]. --тнояsтеn 11:15, 13. Feb. 2014 (CET)

Facharztrichtung

Wenn man in Deutschland einen medizinisch anerkannten Test zur Konzentrationsfähigkeit aus privater Veranlassung machen möchte, an wen wendet man sich (evtl. Facharzt für ...?) --93.134.185.27 13:03, 12. Feb. 2014 (CET)

Google => probleme mit konzentrationsfähigkeit facharzt <= => => Strategie: Hausarzt/Ärztin oder Allgemeinmediziner(in), der/die vorsortiert und weitervermittelt (da es - Ach! - so viele Gründe gibt, warum die Konzentrationsfähigkeit nachlässt). GEEZER… nil nisi bene 13:20, 12. Feb. 2014 (CET) Hatte eigentlich vorgehabt, Konzentrationsfähigkeit zu verlinken, aber das Fremdschämen ist zu stark...
normal würd man da an einen „Facharzt für Psychiatrie und Neurologie“ denken... aber: die würd ich persönlich lieber meiden... vllt reicht n Dipl.-Psychologe? gibt bestimmt herzallerliebste Tests für sowas und privat zahlen muss man ja sowieso... vllt kann man sich auch in nem Assessment-Center testen lassen? --Heimschützenzentrum (?) 13:23, 12. Feb. 2014 (CET)
Dazu müsste man sich zuerst irgendwo bewerben. Und dann genau wissen, dass ein Assessment-Center zur Bewerber-Bewertung herangezogen wird. Und dann einen "Platz" in dem Assessment-Center-Verfahren "ergattern". Assessment-Center ist / sind (ein) Verfahren, keine Einrichtung(en)--217.251.203.124 18:58, 12. Feb. 2014 (CET).
oops... ich dachte, es gäb Firmen, die son „Assessment“ durchführen, damit man nich dauernd den Firmen- internen Psycho auf den neuesten Stand bringen muss... --Heimschützenzentrum (?) 12:12, 13. Feb. 2014 (CET)

Freiwillig im Knast leben

Hallo,

ich würde gerne hautnah für eine Woche verhaftet und in ein Gefängnis gebracht werden, ich will einmal am eigenen Leib erfahren was es bedeutet die Freiheit zu verlieren und eingesperrt zu sein, um im Anschluss selbige wieder besser schätzen zu könne, gibt es eine Möglichkeit? Will unter möglichst realen Bedinungen die Haft absitzen (nicht signierter Beitrag von 84.162.223.170 (Diskussion) 13:55, 12. Feb. 2014 (CET))

Dein Vorhaben in allen Ehren, aber ich glaube, dass ein riesiger Unterschied ist, ob man es freiwillig macht und die Dauer selbst bestimmt und eigentlich auch jederzeit wieder raus kann. --Eike (Diskussion) 13:57, 12. Feb. 2014 (CET)
Zwei Tipps: melde dich zur Bundeswehr, da läufts in der Grundausbildung ähnlich ab. Oder fahr nach Litauen, da gibt es so ein ehemaliges KGB-Gefängnis, das jetzt zu einem Erlebnishotel umgebaut wurde. Da kann man in den Zellen übernachten und am Abend sperrt der Wärter die Türe zu. Wenn du willst, sind sie auch extra unfreundlich zu dir, mit kalten Wasser abspritzen usw., das kostet aber zusätzlich. --El bes (Diskussion) 14:01, 12. Feb. 2014 (CET)
(BK) Wer's zumindest im Fernsehen "erleben" möchte: Olli Schulz macht das wohl in der nächsten Folge von Schulz in the Box (am Montag, 22:10, ProSieben; Werbung Ende). --YMS (Diskussion) 14:02, 12. Feb. 2014 (CET)
1. wenn man einer der Richterinnen von Gäfgen glauben darf, wird man durch die Begehung einer Straftat geisteskrank, so dass man sich ein Gefängnis wohl irgendwie wie ein Krankenhaus vorstellen darf... passt auch historisch... 2. des Weiteren ist es im Gefängnis lebensgefährlich... dort sollen bereits mehrere (Untersuchungs-)Häftlinge von Mithäftlingen zu Tode gefoltert worden sein... der Staat darf es ja nich mehr selbst... Drittwirkung kümmert wohl noch keinen... Justizvollzugsanstalt Siegburg#Die_JVA_Siegburg_in_den_Medien... --Heimschützenzentrum (?) 14:04, 12. Feb. 2014 (CET)
Ich würde ja Einzelzelle wählen, gibt es de jure keine Möglichkeit? Gibt es eine kleine Straftat wie Beamtenbeleidigung für dich mal 2 Wochen oder so eingebuchtet werden kann?--14:13, 12. Feb. 2014 (CET) (ohne Benutzername signierter Beitrag von 84.162.223.170 (Diskussion))
Für Trollfragen gibt´s hier jedenfalls nur virtuelle Strafen.--Optimum (Diskussion) 14:18, 12. Feb. 2014 (CET)
Beamtenbeleidigung gibt es nicht! Es ist Beleidigung wie jede andere Beleidigung auch. (vgl. Ralf Höcker, Rechtsirrtum). Beledigen lässt sich wer nicht erwachsen ist und kein Verständnis gegen sein Gegenüber aufbringen kann oder will, mehr nicht. Vielmehr ist des eine rehtorische Schwäche oder letztes Mittel des Gegenübers. Rufmord oder üble Nachrede ist die Beeinflussung dritter. Wenn der Fragesteller die nicht zu Wissenschaftlichen oder Forschungszwecken machen sollte, sei hier verwiesen, dass Fernsehsender dies mit Videoüberwachung und Gage angeboten hatten. Zudem sei a eine Überprüfung den Selbstwertgefühls zu denken. Zu den anderen Antworten ist noch hinzuzufügen. Es gibt mindestens Gefängnisse, Gefängniskrankenhäuser und Psychiatrien. Und es gab in Gefängnissen durch Mithäftlinge ermordete Häftlinge. --Hans Haase (有问题吗) 14:27, 12. Feb. 2014 (CET)
Wieso Trollanfragen? Zu dem Spaß gibt es sogar einen Wikipediaartikel. Ihr kennt Wikipedia? Nun, wenn nicht, dann solltet ihr es schleunigst kennenlernen. Der Artikel heißt übrigens Gefängnishotel. MfG --Jack User (Diskussion) 14:35, 12. Feb. 2014 (CET)
Siehe https://de.wikipedia.org/wiki/Spezial:Beitr%C3%A4ge/84.162.223.170 --Eike (Diskussion) 14:39, 12. Feb. 2014 (CET)
Auf der Disk dort stehen sogar Beispiele. Juchu, Wikipedia ist auch für Trolle da! :D --Jack User (Diskussion) 14:37, 12. Feb. 2014 (CET)
Das Problem bei richtigen Straftaten ist aber, dass die meist einen recht großen Strafrahmen haben (der Strafrahmen für einfache Beledigung ist z.B. in Deutschland bis einem 1 Jahr [20]), der wird zwar selten auch nur annähernd ausgeschöpft, riskieren würde ichs aber nicht. Wenn man zuverlässig für eine bestimmte Zeit eingesperrt werden will, macht mans am besten so: man fahrt nach Österreich, parkt ein mal oder mehrere Male falsch (oder macht irgendwas anderes harmloses, das bußgeldbewährt ist) und zahlt dann die Strafe nicht, sodnern tritt die Ersatzfreiheitsstrafe an. --MrBurns (Diskussion) 14:40, 12. Feb. 2014 (CET)
Das geht in Deutschland auch, man nennt es hier Erzwingungshaft, siehe auch Zwangshaft. :-P --Jack User (Diskussion) 14:45, 12. Feb. 2014 (CET)
Genau das Stichwort Ersatzfreiheitsstrafe wegen aufgelaufenen Falschpark-Strafen o.ä. wollte ich auch gerade bringen. Hat den Charme, dass man bei Überdruss des Gefängnislebens jederzeit den Rest zahlen kann und sofort freikommt. Solaris3 (Diskussion) 14:47, 12. Feb. 2014 (CET)
Vor dem Experiment unbedingt das Umfeld checken, ob man mit allen im Reinen ist: 14 Tage lebenslänglich. ;) —[ˈjøːˌmaˑ] 14:53, 12. Feb. 2014 (CET)
Rechtshinweis Bitte den Hinweis zu Rechtsthemen beachten!
Einen Knastaufenthalt gibt es in Deutschland normalerweise nur ab einem Monat (Erzwingungshaft für Bußgelder kann aber wohl auch kürzer sein, da bin ich unsicher – kann das jemand klären, wann die „Minimum ein Monat“-Regel gilt? Vllt. die Ein-Monat-Regelung als Ersatz für Geldstrafen, Erzwingungshaft dagegen für Bußgelder?). Das kannst du durchaus bekommen, indem du Bußgelder nicht bezahlst, wiederholtes Schwarzfahren und Erwischenlassen ist oft eine Option. Wenn dir der Aufenthalt zu lang ist, kannst du ggf. durch Bezahlung des Bußgelds den Aufenthalt vorzeitig abbrechen. Ansonsten bieten sich für kürzere Zeiten evtl. auch Untersuchungshaft, die du durch Kautionszahlung womöglich beenden kannst, oder Erzwingungshaft infolge von Aussageverweigerung an, aber das muss man erst einmal arrangieren und man will ja keine weiteren Folgen… --Chricho ¹ ² ³ 14:56, 12. Feb. 2014 (CET)
Untersuchungshaft ist aber nicht sehr empfehlenswert, da muss er schon ordentlich was anstellen und könnte dann vorbestraft sein. Auch ein Delikt vorzutäuschen, erscheint wegen der Strafbewehrung nicht zielführend. Nein, der freundliche Wikipedia-Knastberater empfiehlt definitv die Herbeiführung einer Ersatzfreiheitsstrafe. Aber ich würde das in jedem Fall vorher noch mit einem Anwalt abklären!! Solaris3 (Diskussion) 15:06, 12. Feb. 2014 (CET)
Die Behörde, die mir damals für 10 Deutschmarks einen Tag Erzwingungshaft aufdrücken wollte, war so freundlich mir den Haftbefehl gleich mitzuschicken, wenn ich nicht antanze... Übrigens: man kann auch schöne Experimente machen, siehe dazu Das Experiment (Film). --Jack User (Diskussion) 15:12, 12. Feb. 2014 (CET)

Dem Vernehmen nach gibt es spezialisierte Dienstleisterinnen, die solchen Sehnsüchten nachkommen. Sie sollen mit allerlei Handschellen, Käfigen, Peitschen usw. ausgerüstet sein, ganz nach Wunsch. --178.195.134.244 16:12, 12. Feb. 2014 (CET)

Freiheitsstrafe ... Mindestmaß ein Monat. Aber: Das Mindestmaß der Ersatzfreiheitsstrafe ist ein Tag . Um in deren Genuss zu kommen, kann man sich z. B. durch Fahrgeldhinterziehung um eine Verurteilung zu Geldstrafe bemühen (Mindestmaß fünf Tagessätze). Und wenn der Knast keinen Spaß mehr macht, bezahlt man halt den Rest der Geldstrafe. Für Falschparken gibt's in D'land keine Strafe, sondern ein Bußgeld. Die bei dessen Nichtzahlung mögliche Erzwingungshaft ist nicht dasselbe wie Ersatzfreiheitsstrafe. Vor allem tilgt die Erzwingungshaft das Bußgeld nicht. Sie kann zwar nur einmal verhängt werden. Die Einziehung des Bußgelds durch Zwangsvollstreckung bleibt aber weiter möglich, http://dejure.org/gesetze/OWiG/90.html. --Vsop (Diskussion) 16:35, 12. Feb. 2014 (CET)
Und wo liest man diese Zwangsvollstreckung aus dem Paragrafen heraus? Also ich les' da nix. Und wieso hat sich die Behörde die Mühe gemacht, mir zuerst Erzwingungshaft anzudrohen, wenn sie das Geld viel leichter, schneller und bequemer per Zwangsvollstreckung bekommen hätte? --Jack User (Diskussion) 17:23, 12. Feb. 2014 (CET)
Es gibt tatsächlich einen sogenannten "Knast auf Probe". Während man bei dem Projekt "Ein Blick? - Einblick!" gerade mal 15 Minuten eingesperrt ist, sind es bei dem sogenannten "Warnschussarrest" schon vier Wochen. Bei dem Projekt "Gefangene helfen Jugendlichen" in Hamburg geht es ebenfalls um einen Tag. In der JVA Geldern gibt es auch den Tagesbesuch für straffällig gewordene Jugendliche. Das sind aber immer sozialpädagogische Präventionsprojekte, die für Jugendliche gedacht sind, die kurz vor dem Abrutschen sind und nicht für jemand, der es eigentlich nicht nötig hat und nur neugierig ist. Die Vorstellung, "Einzelzelle zu wählen", ist natürlich lustig ("Hätten sie gerne die überbelegte Zelle mit Seeblick oder die Einzelsuite mit Blick auf den Gefängnishof?"). Aber auch bei Gefängnissen gibt es, so witzig das jetzt auch klingt, einen Tag der offenen Tür. Ich rate zu diesem Weg. Erstmal. --84.191.131.71 17:49, 12. Feb. 2014 (CET) Gab es einen bestimmten Grund, warum dieser Beitrag gelöscht wurde oder war das ein Versehen? --84.191.131.71 17:54, 12. Feb. 2014 (CET)

Wenn Jack User nach den Vorschriften des Verwaltungs-Vollstreckungsgesetzes ... nicht lesen und verstehen kann oder will, kann ihm wohl niemand helfen. Oder doch? https://www.zwickau.de/de/politik/verwaltung/aemter/dezernat1/recht/bg/dienstleistungen/owi_07.php --Vsop (Diskussion) 18:02, 12. Feb. 2014 (CET)

Ob das mal juristisch haltbar ist? Eine Zwangsvollstreckung wegen eines Bußgeldbescheides? Schließlich ist ein Bußgeldbescheid keine Schuld im Sinne des Schuld (Privatrecht). --Jack User (Diskussion) 18:08, 12. Feb. 2014 (CET)
Wenn ich das als juristischer Laie richtig verstehe, so wird zwar eine Erzwingungshaft verhängt (nur einmal), aber danach nicht mehr eingetrieben? So was ähnliches wie bei der Verjährung: die Schuld besteht zwar weiterhin, ist aber nicht mehr eintreibbar, sofern man sich auf die Verjährung beruft? --Jack User (Diskussion) 18:11, 12. Feb. 2014 (CET)
Wenn du dich nicht gerade selbst einer Straftat bezichtigen willst, die du nicht begangen hast um probeweise ein paar Tage in einer Zelle zu verbringen, kannst du vielleicht in einem Kloster vorsprechen. Die können dir auch für eine gewisse Zeit eine Zelle geben und in früheren Zeiten soll es auch welche gegeben haben, die sich einmauern ließen. Sexuelle Übergriffe soll es auch schon in Klöstern gegeben haben, jedoch sind Mönche und anderes Klosterpersonal weit weniger häufig wegen Gewalttaten bekannt als Knastinsassen und mit Gangs und Drogenhandel hast du dort auch nicht so viel zu schaffen. Du könntest deine Haftzeit von vornherein selbst festlegen und eventuell bei Bedarf sogar die Möglichkeit eine vorzeitige Entlassung aushandeln.--Giftzwerg 88 (Diskussion) 18:18, 12. Feb. 2014 (CET)
Vorzeitige Entlassung kostet aber derzeit mindestens 25 Vaterunser und 200 Ave Maria. Im Kloster ist allerdings das Essen besser... --84.191.131.71 18:23, 12. Feb. 2014 (CET)

Die Möglichkeit der Vollstreckung eines Bußgeldbescheides "nach den Vorschriften des Verwaltungs-Vollstreckungsgesetzes" oder "den entsprechenden landesrechtlichen Vorschriften" (§ 90 Abs. 1 OWiG) ungeachtet meiner Erläuterungen gleichwohl in Frage zu stellen, weil ein Bußgeldbescheid keine Schuld im Sinne des Schuld (Privatrecht) ist, bestätigt meinen Verdacht, dass Jack User nicht zu helfen ist. Was ihn zu dem Verständnis veranlasst, es werde zwar eine Erzwingungshaft verhängt (nur einmal), aber (das Bußgeld) danach nicht mehr eingetrieben, bleibt rätselhaft. Tatsächlich ist es so, wie ich bereits schrieb, dass nach erfolgloser Erzwingungshaft die Einziehung des Bußgelds durch Zwangsvollstreckung weiter möglich bleibt. --Vsop (Diskussion) 01:30, 13. Feb. 2014 (CET) P.S.: siehe auch http://www.luebeck.de/bewohner/buergerservice/begriffe/index.html?bid=126

Einfach Jura studieren, da ist das z.T. Ausbildungsbestandteil, mal ein paar Tage einzusitzen, wenn man denn mag. -- Ian Dury Hit me  08:38, 13. Feb. 2014 (CET)

Boston bombing, fake Bilder

Hallo, es gibt wilde Spekulationen das diese Bilder hier:(VORSICHT nicht einfach klicken, dort sieht man "vermeintliche" Bilder von Menschen deren Gliedmaßen "abgesprengt" wurden usw.) {link entfernt} Jedenfalls gibt es Spekulationen das dieses Bilder gefaked sind um den Medien zu nutzen. Gibt es hier irgendeinen Experten der etwas dazu sagen kann? Auf dem ersten Bild sieht das Blut schon sehr nach künstlichem Blut aus. Es gibt noch andere Spekulationen wie hier: {link entfernt}. Irgendwelche objektiven Meinungen dazu?? Gruß--85.181.203.248 16:09, 12. Feb. 2014 (CET)

Die "objektive Meinung" dazu steht unter Anschlag auf den Boston-Marathon. Eine wie auch immer geartete Macht, die es schafft, eine solche Verschwörung zu vertuschen, schafft es auch, das Blut echt aussehen zu lassen. Das ist nur eine der üblichen Verschwörungstheorien. --FGodard||± 17:47, 12. Feb. 2014 (CET)

Die erste von 85.181.203.248 verlinkte Website ist bekannt für anti-israelische Propaganda, 9/11-Verschwörungstheorien und Holocaustleugnung. Die zweite ist nicht viel besser. IMHO sollte das alles hier alsbald gelöscht werden. --91.61.52.243 05:01, 13. Feb. 2014 (CET)

Wirklich??? Oh ok, tut mir leid. Ich hab die beiden Links von einem user einer bekannten Frage&Antwort Plattform. Ich habe die Links rausgemacht. Danke für den Hinweis, obwohl meine Frage nicht wirklich beantwortet wurde, aber ok ich sehe es ein. Gruß--85.180.222.78 13:12, 13. Feb. 2014 (CET)

Müssen Parteien Spenden versteuern?

Frage siehe oben? War der schwarze Koffer von Schäuble nur ein Vergehen gegen das Parteiengesetz (Veröffentlichung) oder auch STeuerhinterziehung? --77.3.135.64 18:11, 12. Feb. 2014 (CET)

Nein - im Gegenteil. Der Staat legt meist noch was oben drauf: Bei Spenden von Privatpersonen werden bis zu einem Betrag von EUR 3300 je Person vom Staat nochmal 38 Cent pro gespendetem Euro als Zuschuss aus Steuermitteln gezahlt. Sagt der Patriarch die Wikipedia. --Snevern 19:41, 12. Feb. 2014 (CET)
Siehe Parteispende. Sie bekommen im Gegenteil vom Staat noch was drauf auf die Spende. Solaris3 (Diskussion) 19:35, 12. Feb. 2014 (CET)
Der Koffer für die CDU z.H. des Herrn Schäuble war von Karlheinz Schreiber (Siehe genauer Karlheinz Schreiber#CDU-Spendenaffäre bzw. Ludwig-Holger Pfahls#Schreiber-Affäre um Panzerlieferung nach Saudi-Arabien). Ergänzende "Beteiligte" siehe auch Walther Leisler Kiep#Spendenaffären und Roland Koch#Spendenaffäre. Die eigentliche Problematik war wohl der Bestechungsvorwurf durch die offensichtliche Verbindung mit Rüstungsexporten von Fuchs-Spürpanzern nach Saudi-Arabien der Regierung unter Helmut Kohl 1991. Zusätzlich sind die "Spenden" in sogenannte schwarze Kassen geflossen, also nicht verbucht worden, was für die CDU später im Rahmen der "Strafe" bzw. Verrechnung nach dem Parteispendengesetz sehr teuer wurde - überigens weit teurer als eine Steuerhinterziehung.
Der umfassendere Artikel dazu ist CDU-Spendenaffäre. --Kharon 22:24, 12. Feb. 2014 (CET)
Und damit es nicht (bzw. nicht noch mehr und nicht die ganz harten Sachen) rauskommt, hat man vor der Übergabe des Kanzleramts an Schröder 1998 die ganzen unschönen belastenden Akten und Dateien geschreddert oder gelöscht [erg.: oder unauffindbar einfach mal in die Konrad-Adenauer-Stiftung ausgelagert], siehe Bundeslöschtage. Und den dadurch ausgelösten, folgenden Bundestags-Untersuchungsausschuss hat man einfach - mit Hilfe der FAZ - durch Rufmord an dessen bis dahin hochrenommierten Leiter erledigt, Burkhard Hirsch - und erreicht, dass der offizielle Bericht nie offiziell veröffentlicht wurde. Saubere Gesellschaft. Solaris3 (Diskussion) 02:16, 13. Feb. 2014 (CET)
Politik wurde schon immer auch mit schmutzigen Tricks betrieben. Sowas wird in der Regel politisch durch Ansehens- und Stimmenverluste viel härter oder nachhaltiger bestraft als juristisch durch eine persönliche Verurteilung. Da hilft dann nichtmal mehr das sogenannte Bauernopfer, wie im Fall Franz Josef Jung in dieser Sache bei Roland Koch vermutet. Im Gegenteil hat sich Koch mit seiner energischen Formulierung "brutalstmögliche Aufklärung" sogar noch ein ironisches Denkmal gesetzt. Er wurde immerhin zuvor als möglicher Kanzlerkandidat der CDU gehandelt und war danach nichtmal mehr als Bundesminister für die CDU vertretbar. Lustigerweise ist dann aber Franz Josef Jung Bundesminister geworden. Vieles erledigt sich in der Politik so von selbst. Überigens können auch formale Anklagen ähnlich als ein schmutziger politischer Trick erscheinen. Siehe aktueller Fall Christian Wulff. Soche Fälle fallen also letztendlich nicht unbedingt "gerechter" aus wenn sie juristisch geklärt werden. Koch und Wulff sind beide politisch raus. --Kharon 03:31, 13. Feb. 2014 (CET)

Was bedeutet Sport (allgemein)

Im Bewerbungsbogen steht: Sport (allgemein)

Was gebeich hier an

Will der Fragende lediglich wissen ob ich Breitensport, Leidtungssport oder Profisport betreibe

nohr h. (nicht signierter Beitrag von 212.185.229.146 (Diskussion) 19:00, 12. Feb. 2014 (CET))

Wenn du irgendwas davon betreibst, ist das ein "Ja", ggf. kannst du ja noch die genaue Sportart dahinterschreiben (wenn du meinst, dass das gut ankommt). --88.130.82.19 19:05, 12. Feb. 2014 (CET)
Siehe hier zum Wort Spiel. Das Wort Sport ist wohl nicht viel weniger kompliziert. --Chricho ¹ ² ³ 19:06, 12. Feb. 2014 (CET)
Um eine Bewerbung für was geht es denn? Wenn das jetzt nicht gerade eine Bewerbung für ein Sportstudium ist, würde ich sagen: Gib einfach nach Gutdünken das an, was du für sinnvoll hältst, du darfst auch Dinge verschweigen. --Chricho ¹ ² ³ 19:52, 12. Feb. 2014 (CET)

Rätsel!

--178.196.10.195 20:08, 12. Feb. 2014 (CET) Ich habe von der Schule ein Rätsel bekommen und muss es so schnell wie möglich lösen. Bitte helft mir!

Ich bin ein kleiner Stern. Ich brenne nicht. 11 Nachbarn sind um mich herum. Meine Anfangsbuchstaben sind P,Q,R und manchmal S.

So,das ist das Rätsel.Ich hofffe ihr wisst die Lösung! Dankeschön XD --178.196.10.195 20:08, 12. Feb. 2014 (CET)

Hilft Europaflagge? --Pp.paul.4 (Diskussion) 20:16, 12. Feb. 2014 (CET)
I live above a Star... und trete dem Lehrer von mir gepflegt in den Hintern (weil er das Rätsel nicht korrekt übersetzt hat). Die Antwort ist "die 7 auf einem Telefon-Touch-Pad"! GEEZER… nil nisi bene 20:51, 12. Feb. 2014 (CET)
Noch ein Übertragungsfehler: Es muss heißen P, R, S und manchmal Q. --Rôtkæppchen68 21:29, 12. Feb. 2014 (CET)
Er hat - wie meist - recht. Also 2 Tritte: Einen hinten (von Geezer) und einen vorn (...) GEEZER… nil nisi bene 21:33, 12. Feb. 2014 (CET)
Momente, in denen ich hier einen „Like button“ vermisse! Die Auskunft ist klasse! :) —[ˈjøːˌmaˑ] 23:04, 12. Feb. 2014 (CET)
<Quetsch> Dafür gibt es die Funktion „Danken“ in der WP, siehe Versionsgeschichte oder Difflinks. --Hans Haase (有问题吗) 03:39, 13. Feb. 2014 (CET) </Quetsch>
Ist mir – wie Du bereits bzgl. der Fotos feststellen durftest – bekannt. Löst aber nicht dasselbe aus wie der „Like Button“ à la facebook: Das Publikum sieht den Dank nicht, nur der Bearbeiter. —[ˈjøːˌmaˑ] 10:27, 13. Feb. 2014 (CET)
Der WP-Dank gilt auch nur für einzelne Bearbeitungen, nicht für das Gesamtergebnis. Muss ich jetzt jeder Bearbeitung einzeln danken, wenn ich einen Abschnitt gut finde? --Rôtkæppchen68 10:44, 13. Feb. 2014 (CET)
Schlimmer noch: Wenn man die ganze WP toll findet, darf man dann einen Bot beauftragen, für jede einzelne Bearbeitung aller Seiten zu danken? Wichtig wäre natürlich ein Filter, dass für z.B. per Huggle revertierten Vandalismus nicht gedankt wird – wo kämen wir da hin?! —[ˈjøːˌmaˑ] 10:59, 13. Feb. 2014 (CET)
Hier das Originalrätsel:

I live above a star, and yet I never burn,
I have eleven neighbours, and yet none of them turn,
I am visited in sequence, first, last or in between,
PRS (& sometimes Q)are my initials, now tell me what I mean

--Rôtkæppchen68 00:10, 13. Feb. 2014 (CET)

Motivierende Einführung in Wiki-Software

Hallöchen,

ich will in unserem Verein eine einstündige Einführung in den Wiki-Syntax und die Vorteile von Wikis geben. Ziel ist es, den Einsatz eines Wikis zu promoten und die anderen zur aktiven Mitarbeit im Wiki zu begeistern :) Technisch kenne ich mich sehr gut aus, aber didaktisch nicht und eine lustige/kreative Idee fehlt mir auch noch.

Ich würde gerne eine praktische und möglichst unterhaltsame Aufgabe stellen, in der die Teilnehmer Wiki-Seiten anlegen, mit Inhalt füllen und einfach formatieren sollen (Überschriften, Fett/Kursiv, Bild, Links). Schön wäre es, wenn dabei der kollaborative Aspekt von Wikis deutlich würde. (Vielleicht könnte man irgendwie den Teilnehmern unterschiedliche Informationen geben, die dann erst über die kollaborative Zusammenführung im Wiki nach und nach ein Gesamtbild ergeben oder ähnliches...?)

Hat jemand eine nette Idee, Anregung oder gar selbst schonmal so eine Einführung gegeben? --88.67.102.35 21:39, 12. Feb. 2014 (CET)

Da gibt es verschiedene Ansprechpartner aus dem Raum Stuttgart. Sonst könnte auch das ehemalige Referentennetzwerk nützlich sein. (Deine IP kommt aus der Gegend) Gruss --Nightflyer (Diskussion) 00:09, 13. Feb. 2014 (CET)

Schrottplätze in Osteuropa

Nabend!

Der eine oder andere treue Auskunfts-Bewohner wird meinen Audi 80 B2 und meine Reiserei kennen. Dieses Jahr wird es durch Polen, die Ukraine, Moldawien, Rumänien, Ungarn und das ehemalige Jugoslawien gehen. Und da setzt meine Auskunfts-Frage an: Aus Erfahrung im Baltikum weiß ich, dass da im „Osten“ noch unheimlich viele Audi 80 unterwegs sind; ich weiß aber auch, dass die kommerziellen „Auto-Schrottplätze“ eher eine deutsche (und niederländische) Tradition sind. Ich würde aber gerne – wenn möglich – meine diesjährige Tour nutzen, um unterwegs ein paar Standard-Ersatzteile günstig abzugreifen.
Hat jemand einen guten Tip, wie ich auf meiner Strecke solche Plätze finde? Gibt es sie überhaupt dort? Wie würde man auf Polnisch, Ukrainisch, Russisch und Rumänisch einen „Schrottplatz“ in unserem Sinne nennen? (Die wörtlichen Übersetzungen der Wörter helfen da nicht viel.)

Gespannte und freundliche Grüße —[ˈjøːˌmaˑ] 22:59, 12. Feb. 2014 (CET)

Na ja, das was du meist, nennt man Autoverwertung. Der ausführende „Autoverwerter“, das ist der Begriff denn du finden musst. Und ja, die gibt es sicher, ist aber durchaus auch eine Vertrauensfrage. --Bobo11 (Diskussion) 23:17, 12. Feb. 2014 (CET)
Viele Teile sind Verschleis- und Austauschteile. Diese gibt's besser neu, auch von Drittanbietern. So wie ich Audis dieser Generation kenne: Leerlaufsteller, Vakuumschläuche, Thermostat- und Kühlmittelaustausch, ggf. Riemen. Lichtmaschine kündigt sich oft an, Regler (Mit Kohlebürsten) kann man nach 150 Mm mal einpacken. Öl und Filter vor Reiseantritt. Bei der Laufleistung darf an das Getriebeöl gedacht werden. Imo hat Audi eine eigene Spezifikation, aber mit GL-5 oder GLs-5 habe ich keine schlechten Erfahrungen gemacht. Domlager, Traggelenke und Spurstangenköpfe sind auch irgendwann mal dran. Dies und hintere Radlager nachstellen verhindert, dass man am Lenkrad rudern muss. Mehr ist doch da nicht. Wer dem Lackschaden zuvorkommt, verhindert den Rostschaden, grade wenn die Karosse verzinkt ist. Im Differentialgetriebe sollte kein Spiel sein. Das ist zuerkennen, wenn ein Antriebsrad angehoben wird und bei eingelegtem Gang mehr als eine Handbreit Abrollfäche gedreht werden kann (Anhaltspunkt, Wartungshandbuch weis es besser). Die Schmiermittel an Bemssattel und Kolben der Bemszyllinder altern und können Probleme machen, die des Wischerlager sind mit Schmutz kontaminiert und es ist kein Fehler diese zu reinigen und mit neuem Schmiermittel zu versehen. Alle Schläuche prüfen! Bremsflüssigkeit ins hygroskopisch, rechtzeitig erneuern. --Hans Haase (有问题吗) 00:30, 13. Feb. 2014 (CET)
YMMD! --тнояsтеn 15:30, 13. Feb. 2014 (CET)
Danke, alles unter Kontrolle, Hans! :)
Ich frage wirklich nach Schrottverwertern in den genannten osteuropäischen Ländern. Sind sie dort üblich wie bei uns? Nach welchen Begriffen in den jeweiligen Landessprachen würde man üblicherweise suchen (Was würde der durchschnittliche westukrainische Autoverwerter auf sein Schild schreiben?) —[ˈjøːˌmaˑ] 10:25, 13. Feb. 2014 (CET)
Ich bin schon zweimal quer durch den Balkan (erzwungenermassen) auf Landstrassen gedüst. Auf der Strecke Villach - Maribor - Varaždin - Novi Sad - Belgrad gibt es unzählige kleine bis größere Schrottplätze. Im Großraum Belgrad besonders viele. Auch auf der Strecke Nagykanizsa - Pécs - Baja - Szeged - Timișoara sind mir ein paar aufgefallen. Einen genauen Lageplan könnte ich nicht mehr zeichnen, aber wenn Du auf den Staatsstrassen bleibst, kommst Du alle paar 50 Kilometer an einem vorbei. --Hosse Talk 11:16, 13. Feb. 2014 (CET)
Nachtrag: In Deutschland ist es heutzutage ja leider so, dass es die klassischen Schrottplätze kaum noch gibt. Wahrscheinlich zu viel Aufwand für den Ertrag, denn wer schraubt noch selbst an den mit elektronikverseuchten Kisten rum? Je weiter Du allerdings östlich, südöstlich und südlich kommst, siehst Du die Verwerter an jeder Strassenecke. Meist sind das Werkstätten mit nem großen Platz hintendran, wo sie ihre "Ersatzteile" lagern. Normalerweise steht dann "Autoservis" oder Ähnliches auf den Schildern (jedenfalls dort wo ich durchgefahren bin). Aber Schrottplätze erkennt man ja auch so... ;-) --Hosse Talk 11:24, 13. Feb. 2014 (CET)
Nach dem Bundesimmissionsschutzgesetz müssen Freiflächen entwässert und das Abwasser durch einen Leichtflüssigkeitsabscheider gereinigt werden usw. Solche Gesetze gibt´s östlich und südlich wohl nicht. Wahrscheinlich gibt´s da nichtmal so lange Wörter. --Optimum (Diskussion) 12:24, 13. Feb. 2014 (CET)
Klasse, danke für die Tips! Zur Rallye: Ach, Du bist so einer? Respekt! Habe neulich einen Bericht darüber gesehen und wollte mich und meinen Typ81 sofort anmelden. Abgehalten haben mich die Proteste meiner Frau und die Tatsache, dass man das Auto am Ende für wohltätige Zwecke dalassen sollte. ;) —[ˈjøːˌmaˑ] 11:29, 13. Feb. 2014 (CET)
Gerne. Ich hab noch 2 Fotos gefunden. Die Autos dann abzugeben schmerzt extrem. Da muss man schon ne Träne verdrücken, vor allem nachdem man die Dinger ja eigentlich ein Jahr lang von Grund auf überholt und gestaltet hat. Diese Rallye wird eh immer kommerzieller und teurer, es gibt aber nette Alternativen. --Hosse Talk 12:25, 13. Feb. 2014 (CET)
Cool. :) —[ˈjøːˌmaˑ] 12:47, 13. Feb. 2014 (CET)

Ungarn: autóbontó. Polen: złomowania samochodów / złomowania pojazdów. Ukraine: утилізація автомобілів. --тнояsтеn 13:35, 13. Feb. 2014 (CET)

Woher kommt der Name Blinde Rot

Aus der Suchhilfe hierher übertragen. von GEEZER… nil nisi bene 09:41, 13. Feb. 2014 (CET) (Früher hiess sie auch Roth ...)

-91.18.245.103 09:08, 13. Feb. 2014 (CET)

Laut "blinde+rot"&dq="blinde+rot"&hl=de&sa=X "Blinde Rot = Finstere Rot" --AndreasPraefcke (Diskussion) 10:29, 13. Feb. 2014 (CET)

Hatte ich auch bei GoogleBooks gefunden, aber es scheint da 2 zu geben (vielleicht hat man bei der einen das "finstere" mitgenommen, während man es bei der anderen verloren hat...) GEEZER… nil nisi bene 10:48, 13. Feb. 2014 (CET)
(BK)… warsch. im Sinne von undurchsichtig, nicht klar (vgl. „blinde Fensterscheibe“).
Es gibt zahlreiche Flüsse mit dem Namen(sbestandteil) Rot, bspw. Rot (Kocher). Hier (nicht mehr ganz aktuell) wird eine Verwandschaft mit engl. road vermutet. Findet jemand was zeitgemäßeres zur Etymologie? Grüße  TRN 3.svg • hugarheimur RIP Klara Winter 10:49, 13. Feb. 2014 (CET)
Hierdurch "Undurchsichtigkeit" belegt. GEEZER… nil nisi bene 10:53, 13. Feb. 2014 (CET)

Konservierungsmittel und Antioxidantien

wo liegt der Unterschied zwischen Konservierungsmittel und Antioxidantien z.B. in Kosmetikprodukten ?

--91.212.243.4 11:35, 13. Feb. 2014 (CET)

Konservierungsstoffe verhindern, dass sich Mikroorganismen wie Bakterien und Pilze über das Produkt hermachen. Antioxidantien verhindern, dass sich der Luftsauerstoff über das Produkt hermacht. --Rôtkæppchen68 11:44, 13. Feb. 2014 (CET)

Jacob Burckhart

Laut des Artikels Walter von Molo gehörte Jacob Burckhardt nebem von Molo und anderen während der Zeit des Nationalsozialismus zum Vorstand der Weimarer Goethegesellschaft. Dies ist offensichtlich falsch, da Burckhardt einerseits Schweizer und andererseits damals bereits seit mehreren Jahrzehnten tot war. Gibt es eine Person mit einem ähnlichen Namen, die im Vorstand der Goethegesellschaft gesessen haben kann?

--SFfmL (Diskussion) 15:02, 13. Feb. 2014 (CET)

Vermutlich Carl Jacob Burckhardt (siehe [21]). --тнояsтеn 15:14, 13. Feb. 2014 (CET)
Näheres dürfte man hier erfahren: [22]. Kann ich heute abend mal reinschauen. --тнояsтеn 15:28, 13. Feb. 2014 (CET)
Einzelnachweise anschauen hat auch noch nie geschadet: [23]. Erledigt? --тнояsтеn 15:57, 13. Feb. 2014 (CET)

HTML-Code / Bedingte Weiterleitung zu anderen HTML-Dateien (Erledigt)

Ich habe da gerade im Bereich Informatik ein Problem: Ich erstelle gerade eine Internetseite, die eine Datenbank ist. Die Struktur soll mit zwei Frames realisiert werden. Der linke Frame soll das Hauptmenü und der rechte Frame den Datenbereich enthalten. Aktuell habe ich bereits knapp 6000 Datensätze zusammen, die alle mit Suchmaschinen (Google, Yahoo, ...) auffindbar sein werden. Mein Problem ist nun, dass wenn man in einer Suchmaschine den betreffenden Link anklickt, nur die betreffende HTML-Datei mit dem Datensatz kommt, aber nicht das Hauptmenü. Gibt es eine Möglichkeit, dass eine HTML-Datei automatisch eine vorgegebene andere HTML-Datei aufruft, wenn sie nicht innerhalb eines Frames geöffnet wurde? Falls dies nicht möglich sein sollte, dann müsste ich wahrscheinlich auf Frames verzichten und das Hauptmenü in jeder einzelnen HTML-Datei einbauen, wodurch meine Internetseite etwa 40 Megabyte mehr Speicherplatz verbrauchen würde.

Den Programmieraufwand erledigt übrigens eine von mir entwickelte Software, die die HTML-Dateien vollautomatisch erzeugt. --Sassenburger (Diskussion) 04:59, 15. Feb. 2014 (CET)

Ich weiß, dass das mit Javascript geht, aber wie, weiß ich nicht. --Rôtkæppchen68 05:07, 15. Feb. 2014 (CET)
Mir fällt nur eine JavaScript-Lösung ein, etwas in der Art, das etwa über via body-Tag oder als Script im head-Bereich der Inhaltsseiten aufgerufen wird: onload="if ( self.location == top.location ) top.location = '/index.html';" wobei index.html eben das Frameset ist. Dem müsste man dann halt noch mitteilen, welche Inhaltsseite gerade angezeigt werden soll (z.B. über PHP als Paramter an das '/index.html' anhängen). Das ist jetzt keine fertige Lösung, aber in der Richtung könnte es funktionieren. --Tsui (Diskussion) 05:09, 15. Feb. 2014 (CET)
Wie baut man denn Java-Zeilen ein? --Sassenburger (Diskussion) 05:23, 15. Feb. 2014 (CET)
JavaScript nicht Java. Im oben beschriebenen Fall z.B. als kurzes Script im head-Bereich der Seite:
<head>
<script type="text/javascript>
if (top.location == self.location)
top.location.href="index.html"
</script>
</head>
Oder im body-Tag: <body onload="if ( self.location == top.location ) top.location = '/index.html';">
Mehr und Details finden sich auf der immer noch fabelhaften Website SELFHTML: Zugriff auf verschachtelte Fensterobjekte. --Tsui (Diskussion) 05:33, 15. Feb. 2014 (CET)
Super! Die erste Lösung funktioniert, die zweite (body-Tag) jedoch nicht. Da hat aber in der zweiten Zeile ein Anführungszeichen gefehlt. --Sassenburger (Diskussion) 05:41, 15. Feb. 2014 (CET)
Fein, freut mich, dass ich helfen konnte. --Tsui (Diskussion) 05:55, 15. Feb. 2014 (CET)
(BK)Nicht Java, das ist etwas anderes als JavaScript. Javascript kannst Du direkt in Deinen HTML-Code einbetten, z.B. mit <html><title>Seitentitel</title><script>/*hier JavaScript-Code plazieren*/</script><body onload="foo();">Seiteninhalt</body></html>. --Rôtkæppchen68 05:39, 15. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: Tsui (Diskussion) 08:24, 15. Feb. 2014 (CET)

Musikkenner gesucht (italienische Filmmusik?)

Eine Frage an Kenner der (vermutlich) italienischen Musik oder (vielleicht) auch Cineasten: Weiß vielleicht jemand, welches Stück bei diesem Youtube-Clip als Soundtrack dient: [24]? Es kommt mir stellenweise sehr vertraut vor, aber ich komme nicht drauf woher ich es kenne. Eine Ahnung weist in Richtung italienischer Film aus den 1960ern, vielleicht auch ein Hollywood-Streifen der in Italien spielt, aber sicher bin ich nicht. --Tsui (Diskussion) 05:01, 15. Feb. 2014 (CET)

Das steht rechts unterhalb des Videos: Torna A Sorriento - Accordion Meltdown --TP12 (D) 07:35, 15. Feb. 2014 (CET)
Danke! Das sehr Seltsame daran ist, ich sehe das nirgendwo auf der Seite. Auch weder die browsereigene Suchfunktion findet die Stichworte, noch entdecke ich sie, wenn ich den Quelltext durchsuche. Dank Deines Hinweises kam ich dem Stück jetzt auf der Spur, es gibt einen Film it:Torna a Sorrento (I 1945) und vor allem das italienische Volkslied von 1902 namens Torna a Surriento (hier mit Pavarotti, und Elvis es auch verarbeitet). Accordion Meltdown ist ein Album, auf dem das Stück von Dominic Cortese (huch, rot) interpretiert wird - womit wir wieder beim Ausgangsvideo wären, wo diese Aufnahme verwendet wird. Schön. Danke Dir! --Tsui (Diskussion) 08:14, 15. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: Tsui (Diskussion) 08:24, 15. Feb. 2014 (CET)

Funktionsweise des Thermometers

Beim Ausdehnungsthermometer steigt bzw. fällt die Flüssigkeitssäule im Glasröhrchen, da sich das Volumen der Flüssigkeit bei unterschiedlicher Temperatur ändert. Das Thermometer ist oben normalerweise geschlossen. Frage: Ist Luft im Glasrohr? Wie stark kann sie bei steigender Temperatur komprimiert werden? Ist die Skala trotzdem linear? Eine Schülerin (7 Jahre alt) vermutete, dass das Glasrohr doch offen sein muss, damit die Flüssigkeit steigen kann. Was kann ich ihr antworten?--84.57.77.255 18:12, 12. Feb. 2014 (CET)

--84.57.77.255 18:12, 12. Feb. 2014 (CET)

Luft ist kompressibel, daher kanns natürlich trotzdem steigen. Zur Linearität der Skala: eine ideale Flüssigkeit ist inkompressibel, daher wäre die Skala trotzdem linear, bei einer realen Flüssigkeit ist eine gewisse Kompressibilöität vorhanden, aber bei weitem nicht so stark wie bei Luft, die in einem großen Druckbereich in sehr guter Näherung ein ideales Gas ist, daher gilt in sehr guter Näherung P*V = n*R*T, wobei R und in unserem Fall auch n konstant ist. Daher es gibt eine gewisse Abweichung, die könnte allerdings im Vergleich zur sonstigen Meß- und Ableseungenauigkeit möglicherweise vernachlässigbar sein. Wenn im Thermometer Vakuum herrscht gibt es jedenfalls kein Problem, solange die Temperatur nicht so stark steigt, dass die Flüssigkeit selbst keinen Platz mehr in der Säule hat. In diesem Fall könnte es sein, dass das Glas zerbricht, deshalb sollte man Thermometer nie Temperaturen zu weit ober ihres Anzeigebereichs aussetzen.--MrBurns (Diskussion) 18:24, 12. Feb. 2014 (CET) PS: wie du das jetzt einer Siebenjährigen am besten erklärst, kannst du dir selber überlegen (oder vielleicht hilft dir jemand anderer dabei). --MrBurns (Diskussion) 18:25, 12. Feb. 2014 (CET)
(BK)Die Flüssigkeit im Flüssigkeitsthermometer, egal ob Quecksilber, Alkohol, Pentan, Galinstan oder so lässt sich fast gar nicht zusammendrücken. Die Luft über der Flüssigkeit lässt sich problemlos zusammendrücken. Erst wenn die Flüssigkeits das Glas fast ganz ausfüllt wird der Druck im Thermometer so stark, dass es platzt. Bei einem oben offenen Thermometer würde ständig Flüssigkeit verdunsten, sodass das Thermometer schnell nachgehen würde. --Rôtkæppchen68 18:26, 12. Feb. 2014 (CET)
Als Bastelversuch für die siebenjährige Schülerin: Eine Injektionsspritze (ohne Kanüle natürlich) einmal mit Wasser, einmal mit Luft füllen, vorne zuhalten und dann drücken. Falls keine Injektionsspritze verfügbar ist, kann auch eine Luftpumpe (Fahrrad oder Ballpumpe) verwendet werden. --Rôtkæppchen68 18:29, 12. Feb. 2014 (CET)
Unabhängig von den Antworten, wieso Luft in einem realen Thermometer keine Rolle spielt: Eine Nichtlinearität wäre auch kein Problem, solange sie bekannt ist und bei der Kalibration berücksichtigt wird. Man dürfte ein solches Thermometer dann eben nicht als Lineal zweckentfremden... --mfb (Diskussion) 12:42, 13. Feb. 2014 (CET)
Auch der Volumenausdehnungskoeffizient der Thermometerflüssigkeit ist über den Messbereich des Thermometers nicht konstant. Also wird die Skale des Thermometers so oder so ein bisschen nichtlinear. Bei anderen Thermometern ist das aber ebenso, z.B. beim Nickel-Widerstandsthermometer. --Rôtkæppchen68 12:55, 13. Feb. 2014 (CET)
Bei einem Quecksilber-Glasthermometer bzw Fieberthermometer - um das es wohl geht - ist über der Flüssigkeit Stickstoff oder Luft bei Unterdruck bzw ein partielles Vakuum: http://en.wikipedia.org/wiki/Mercury-in-glass_thermometer : "The space above the mercury may be filled with nitrogen or it may be at less than atmospheric pressure, a partial vacuum." Die Skala ist für °Celsius tatsächlich nicht-linear, wie man mit bloßem Auge erkennen kann (für die niedrigen Temperaturen sind die Striche enger beisammen, für die höheren weiter auseinander). Zum Erstellen der Skala wird das Thermometer kalibriert, indem es (noch unskaliert) bekannten Fix-Temperaturen ausgesetzt wird: zB 0 °C Wasser-Eis-Gemisch, sowie 100 °C Wasser-Dampf-Gemisch. Bei Fahrenheit sind die Abstände der Striche auf der Skala hingegen offenbar gleich. (Wohl, weil Celsius die thermodynamische Temperatur abbildet, während Fahrenheit wohl veraltet und ungenau mit Fixpunkten von Körpertemperatur, Siedepunkt von Wasser und seinem Eis-Wasser-Salz-Gemisch-Gefrierpunkt - irgendwie in gleiche Abstände unterteilte?). Verschiedene Skalen verwenden teils verschiedene Fixpunkte, wie Körpertemperatur oder Tripelpunkt, siehe Grad_Fahrenheit#Temperaturskalen). Gegenüber der physikalisch-wissenschaftlichen Kelvin-Skala ist °Celsius nur um 273,15 Einheiten verschoben.
Deine Schülerin hat also intuitiv die Schwierigkeit erahnt, Temperatur exakt zu messen und Thermometer zu kalibrieren und zu skalieren, wenn sie sich über die Druckverhältnisse im Thermometer wundert und geht neuem Wissen erstmal selber auf den Grund, lieber, bevor sie kritiklos den Lehrplan frißt ;o]). --217.84.69.72 17:08, 13. Feb. 2014 (CET)
Daniel Gabriel Fahrenheit ist ursprünglich von der Körpertemperatur als oberem und einer bestimmten Kältemischung als kälteste ihm bekannte Temperatur als unterem Fixpunkt ausgegangen. Er stellte aber fest, dass diese Fixpunkte nicht problemlos reproduzierbar sind und ist deswegen wie die anderen Thermometerbauer (Anders Celsius, René-Antoine Ferchault de Réaumur) auf Schmelz- und Siedepunkt des Wassers umgestiegen. Seine Skala hat er aber beibehalten, nur eben den Schmelzpunkt des Wassers als 32 °F und den Siedepunkt des Wassers als 212 °F definiert. --Rôtkæppchen68 17:23, 13. Feb. 2014 (CET)
Die Fahrenheit-Einteilung geschah also willkürlich in gleiche Abstände, während die Skalierung der °Celsius-Skala nach einer Formel für thermodynamische Temperatur erfolgt? Die Abstände der Striche dann einzeln errechnet werden müssen (?) / geometrisch abgetragen werden müssen (?) ? Noch dazu unterschiedlich je nach Flüssigkeit und diversen Variablen, wie Ausdehnungskoeffizient; Oberflächenspannung; Reibung / Haftung / Bremsung an der Glaswand? Ungenauigkeiten der Röhre uvm.? Dasja hochkomplex. :oO Von wegen °exakt°. --217.84.69.72 17:36, 13. Feb. 2014 (CET)
Das mag historisch stimmen, heute ist die Fahrenheit-Skala aber Exakt und wird durch eine einfache Umrechnungsformel aus der Kelvin-Skala bestimmt und die Temperaturunterschiede sind linear (die Formel lautet: TF = TK· 1,8 − 459,67). Daher wenn das thermometer nicht uralt ist, ist ein Fahrenheit-thermopmeter genaus genau wie ein Celsius-Thermometer (natürlich sind generell nicht alle Thermometer genau kalibiriert, bei Fieberthermometern gibst wohl gesetzliche Vorgaben zur Genauigkeit, bei Zimmerthermometern aber eher nicht, da ist es keine Seltenheit, dass man wenn man 2 Thermometer nebeneinander stellt, zwischen beiden 2°C Unterschied hat. Moderne Flüssigkeits-Thermometer verwenden übrigens kein Quecksilber mehr, Quecksilberthermometer dürfen in der EU nicht mehr verkauft werden. --MrBurns (Diskussion) 18:31, 13. Feb. 2014 (CET)
ok danke! --217.84.69.72 00:16, 14. Feb. 2014 (CET)

Wie funktioniert Wetterfühligkeit?

Wie funktioniert Wetterfühligkeit? Woher weiß das operierte Schienbein, dass das Wetter heute regnerisch und wechselhaft ist, um dann passend zum Wetter wehzutun? Warum konnte das Schienbein das vor dem Knochenbruch und der anschließenden Operation nicht? Warum funktioniert das auch in Innenräumen, wo das regnerische und wechselhafte Wetter nicht hinkommt? Der Artikel Wetterfühligkeit ist leider viel zu kurz und viel zu allgemein. Der Artikel Meteorotropie hilft mir auch nicht weiter. --84.143.223.196 17:06, 13. Feb. 2014 (CET)

Wetterfühligkeit: „Als Ursachen werden Schwankungen des Luftdrucks und so genannte Atmospherics (kurz Sferics) diskutiert.“ --BlackEyedLion (Diskussion) 17:16, 13. Feb. 2014 (CET)
Änderungen des Luftdrucks scheinen zumindest zu meiner eigenen Erfahrung zu passen. Ich habe oft Kopfschmerzen - und deren "Abhängigkeit vom Wetter" schon früh erkannt - und sie gehen immer (Trefferquote 100% seit Beginn der "Aufzeichnungen" vor 3 Jahren!) mit Änderungen des Luftdrucks (in beiden Richtungen) einher--Alexmagnus Fragen? 17:27, 13. Feb. 2014 (CET)

Bundespressekonferenz

Wo kann man sich die Bundespressekonferenz live ansehen oder wo kann man alle vergangenen Konferenzen als Video ansehen? --93.132.21.93 17:32, 13. Feb. 2014 (CET)

Z. B. bei phoenix, aber die übertragen vermutlich auch nicht sämtliche PKs. --Verwaltungsgliederung (Diskussion) 21:58, 13. Feb. 2014 (CET)

Masora

Prozentzahlen der Texttypen

Warum hat der masoretische Text bei Bibelübersetzungen so eine große Autorität? Er ist ja über tausend Jahre jünger als die LXX und immer noch 500 Jahre jünger als selbst die Vulgata: der masoretische Archetyp war also um viele Jahrhunderte länger der Überlieferung ausgesetzt als die Vorlagen der Archetypen von LXX, Vulgata und Hexapla. Die Kumran-Hss. sind näher an der LXX als am masoretischen Text. Warum sieht man also den masoretischen Text als so besonders authentisch an, was er doch bis auf die Sprache anscheinend gar nicht ist? --77.186.46.113 17:57, 13. Feb. 2014 (CET)

Grob gesagt sind Übersetzungen damals häufig bessere Paraphrasierungen gewesen. Man hat das übersetzt, was man verstanden hat, den Rest weggelassen oder eigene Deutungen hinzugefügt. Insbesondere war das Hebräische schon damals nur noch heilige Sprache und wurde nicht mehr auf muttersprachlichem Niveau beherrscht. Daher gilt die Ursprache mehr als die Übertragung in eine andere Sprache. Ich zitiere aus Herbert Hunger et al.: Die Textüberlieferung der antiken Literatur und der Bibel, S. 155 zur Masora: „Der Vergleich ... führt zu dem Ergebnis, dass es etwa vom Jahre 100 n. Chr. an einen nahezu uniformen hebräischen Text gegeben haben muss, mit dem die Masora in der Hauptsache identisch ist“, S. 160 zur LXX: „Die Treue der Übersetzung ist sehr verschieden. Der Pentateuch scheint sich am ehesten an den hebräischen Text anzuschließen. Die Übersetzungen von Jesaja und den kleinen Propheten sind ausgesprochen schlecht; der griechische Daniel ist nur eine Paraphrase der hebräischen Vorlage.“--Pp.paul.4 (Diskussion) 19:33, 13. Feb. 2014 (CET)
Es stimmt so nicht ganz. Die Septuaginta ist eine ordentliche Übersetzung, die zur Zeit Qumrans offiziell anerkannt war. Abweichungen sind oft nicht auf die Phantasie der Übersetzer zurückzuführen sondern auf verschiedene Textgrundlagen. Es gibt eine Reihe von Texten in Qumran, die im Text verschiedenen Versionen nahestehen. Es gibt welche, die stark der LXX ähneln, andere wiederum anderen Textvarianten, die Mehrheit der Texte in Qumran ähnelt dem Masoretischen Texttyp. Der unbestreitbare Vorteil des masoretischen Textes ist, dass er in der Originalsprache überliefert ist und wirklich alle Teile umfasst. Die Qumrantexte sind wie dargestellt sehr heterogen, mit unterschiedlichen Textfassungen, aber teilweise auch sehr zerstückelt und lückenhaft, so dass man nicht einfach die Qumrantexte hernehmen kann und auch nicht aus mehreren Handschrifen einen Text, indem man die lücken des einen Manuskripts mit Teilen eines anderen Manuskripts ergänzt. Zur Zeit läuft aber ein Projekt, das die Qumranhandschriften für eine neue wissenschaftliche und textkritische Ausgabe des Textes berücksichtigen will. Bis dieser Text verfügbar ist, ist der masoretische Text die beste Grundlage für die Übersetzung. Daniel ist übrigens nicht hebräisch geschrieben und auch in diesem Fall ist nicht klar, welche Vorlage der Übersetzer hatte. Masora ist im übrigen nicht der Begriff für den masoretischen Text, sondern die Masora sind die Randnotizen und Verstehenshilfen der Masoreten z. B. Quere ist von den Masoreten.--Giftzwerg 88 (Diskussion) 20:14, 13. Feb. 2014 (CET)

Französische Lafette aus dem 19. Jh.? - Wer kennt sich aus

Hallo, ich suche mal wieder einen Spezialisten, diesesmal geht es um eine alte Kanone, die im lippischen Kalletal, Ortsteil Langenholzhausen auf einer kleinen Flußinsel (?) in der Kalle befindet. Wer kann mir da weiterhelfen? Bilder schicke ich auf Anforderung und lade sie bewusst nicht auf Commons. LG und Dank --Gwexter (Diskussion) 18:52, 13. Feb. 2014 (CET)

Ich kann die Bilder gerne mal an den Militaria handelnden franz. Nachbarn weiterleiten. Ein interner Grössenvergleich wäre sinnvoll. GEEZER… nil nisi bene 19:14, 13. Feb. 2014 (CET)
Hallo Geezer, du findest zwei Bilder unter diesen Adressen: www.gwexter.org/kanone1.jpg und www.gwexter.org/kanone2.jpg. Ich war zwar heute dort (ich habe mich hier eh als in Exter (Vlotho) lebend geoutet), blöderweise aber keinen Zollstock etc. mitgenommen. Fiel mir erst in Langenholzhausen ein. Auf der Rohrseite des Geschützes, wo man die Munition reinstopft, sind Daten eingeprägt. Zum Umfeld: Es wird vermutet, dass die Kanone von 1872 stammt, aber auch, dass sie im ersten Weltkrieg verwendet wurde oder aber auch, dass die Bewohner von Langenholzhausen sie zur Verteidigung gegen die "bösen" Franzosen aufgestellt hätten. Dann müsste FR freilich Richtung Nord-Nord-Ost stehen, wohin die Mündung zeigt. Zum Hermannsdenkmal im Teutoburger Wald ist bekannt, dass er mit seinem Schwert gen Westen dräute, was wohl so gewollt war. Allen drei Einordnungen vertraue ich nicht so recht, es gibt eben Dorfhistoriker und Dorfhistoriker, du verstehst sicher, was ich meine. Ich habe mit dem Gemeindearchivar von Kalletal, wozu Langenholzhausen gehört, geplaudert, der aber auch nicht helfen konnte. Es scheint auch keine verlässliche Quelle zu existieren. LG --Gwexter (Diskussion) 19:36, 13. Feb. 2014 (CET) PS. Evtl. wäre das auch ein netter Artikel für die WP.
Das sind Reste einer De Bange, 155 mm Kaliber, Modell 1877; dürfte also wohl ein dereinst eher wertloses Beutegeschütz des ersten Weltkrieges sein. *snipps* --Dansker 19:30, 13. Feb. 2014 (CET)
Hallo Dansker, das könnte passen, das Ding in L. sieht genau so aus, nur ohne Fahrgestell. Das Kaliber passt auch irgendwie. Wann das Teil dort aufgestellt wurde, konnte ich noch nicht ermitteln.
Hej Gwexter. In den 1930ger Jahren war Deine Schiesskanone schon so angenagt ihrem Robinsongeschick ergeben. --Dansker 19:50, 13. Feb. 2014 (CET) P.S.: He, auf Deinem Bild vom Bundstück steht ja alles: Kaliber 120 mm, Modell 1878, Hersteller Fonderie et arsenal de Bourges und Baujahr 1886. Voilà ...
Na, guck mal einer an, wäre ich nicht drauf gekommen, ich kann auch mal gerade soeben den Sinn von Fahrzeugnummernschildern erfassen (*grins*). Jetzt noch rausfinden, wann und warum genau aufgestellt. Die Postkarte kannte ich, aber da steht auch nix weiter dabei, war mir auch nicht deutlich genug. Danke euch beiden erst mal für Hilfe und Bereitschaft. --Gwexter (Diskussion) 20:25, 13. Feb. 2014 (CET)

Kälber

Ab wann können Kälber sehen?--84.150.219.84 18:58, 13. Feb. 2014 (CET)

Wenn sie gesund zur Welt kommen: Ab dem Tag ihrer Geburt. In Minuten kann ich's nicht angeben. --Snevern 19:13, 13. Feb. 2014 (CET)
Rinderkälber: Die Augen gehen bei einigen während der Geburt sofort nach Austritt des Kopfes auf und ab dann können sie auch sehen. Sie sehen bei ihrer eigenen Geburt zu. Bei anderen gehen sie erst ein paar Minuten später auf. Bei Wal-, Elefanten- oder Mondkälbern weiß ich es nicht. 46.115.130.204 19:15, 13. Feb. 2014 (CET)
Wobei die Frage so ohnehin nicht beantwortet werden kann. Die Jungtiere vieler Tierarten heißen Kälber, da kann es schon Tierarten geben wo die Jungtiere blind zur Welt kommen.--Antemister (Diskussion) 19:26, 13. Feb. 2014 (CET)
Das ist natürlich richtig, war ein echter Auskunfts-Anfänger-Fehler: Unter lauter Besserwissern darf man sich solche Patzer nicht erlauben, schon gar nicht, wenn man selber einer ist. Ich geh jetzt ins Wohnzimmer und streue Asche auf mein Haupt. --Snevern 19:55, 13. Feb. 2014 (CET)
So schlimm ist es nicht, ein Besserwisser zu sein. Solange jemand kein Kalb ist, ist doch alles okay. 46.115.130.204 20:35, 13. Feb. 2014 (CET)
Snevern, gräm dich nicht, du kannst ja zum Ausgleich morgen mal beim Metzger fragen, von welchem Tier seine Kalbsschnitzel kommen … -- HilberTraum (Diskussion) 20:53, 13. Feb. 2014 (CET)
Nicht alle Metzger sind Rindviecher. Yotwen (Diskussion) 21:45, 13. Feb. 2014 (CET)

Tote Giraffe Kopenhagen

Hätte es eigentlich nicht ausgereicht den Bullen zu sterilisieren oder spräche etwas dagegen ?

--85.179.35.242 17:18, 10. Feb. 2014 (CET)

Der könnte sich ja noch anderweitig fortpflanzen. Blödsinn, ignorieren. Es wurde ja eben dieser Bulle verfüttert, kein Weibchen. -- MonsieurRoi (Diskussion) 17:24, 10. Feb. 2014 (CET)
Hauptgrund waren wahrscheinlich die Kosten für Futter, Betreuung und Unterbringung. Im eigenen Zoo konnte man ihn nicht halten und andere Zoos in Europa wollten ihn nicht. Dass sie das Tier auch an einen Zirkus oder einen exzentrischen Millionär verkaufen hätten können, ist den Beamten wohl nicht eingefallen. --El bes (Diskussion) 17:28, 10. Feb. 2014 (CET)
Wobei ich gelesen habe, dass es sehr wohl einen Zoo gab, der angeboten hatte, das Tier zu nehmen. Wie dann dort die Lebensbedingungen gewesen wären, ist eine andere Frage, aber dass es - wie vom abgebenden Zoo behauptet - gar keinen Abnehmer gegeben hätte, ist schlicht gelogen. Es stimmt sicher, dass ein sterilisiertes Tier sich nicht mehr fortpflanzen kann, aber es scheint, dass gar nicht die Fortpflanzung der Giraffe das eigentliche Problem war, so dass eine Sterilisierung vll. gar nicht mal geholfen hätte. Was man aber häe machen können (außer das Tier abzugeben), wäre: Man hätte die Giraffe sicher auch auswildern können. Ich sag gar nicht, dass das ein einfaches Unterfangen und mal eben so machbar ist, aber wo ein Wille ist, ist auch ein Weg. Ich seh das auch wie El bes: So ein Tier zu halten kostet Geld und laut Spiegel hatte der Zoo schlicht nicht genug Platz. Wenn ein Zoo Tiere hält, dann sehe ich ihn auch in der Verantwortung für diese Tiere und sie einfach so zu töten finde ich falsch. Ich halte dieses Verhalten - wenn nicht sogar für verboten - dann doch zumindest für moralisch äußerst fragwürdig. --88.130.67.161 17:41, 10. Feb. 2014 (CET)
Mehr als ein Bulle geht nicht in einer Giraffenherde. Auch nicht ein sterilisierter. Der Zoo, der diesen Bullen übernehmen wollte, hält keine Giraffen und gehört nicht zu der Zoovereinigung. --TP12 (D) 17:45, 10. Feb. 2014 (CET)
Ja und? Ich hatte mehr erwartet, dass hier das Argument käme: "Was kann der Zoo dafür, dass die Giraffe da ist?" Eine ganze Menge: Dass die Tiere sich paaren ist ja jetzt keine Weltneuheit. Da hätte der Zoo sich halt vorher um die Unterbringung des Nachwuchses kümmern müssen oder notfalls eben Maßnahmen ergreifen müssen, um die Fortpflanzung zu vermeiden. Fakt ist: Es gab Mittel und Wege dieses Problem auch anderweitig zu lösen. Warum ein gesundes Tier dann gerade umgebracht werden muss, erschließt sich mir nicht. --88.130.67.161 18:00, 10. Feb. 2014 (CET)
Ja und? Jetzt war das Problem halt da und musste gelöst werden. Dass Zootiere im Zuchtprogramm umgebracht werden ist ja jetzt wirklich keine Weltneuheit. Fakt ist: so hatten die Löwen naturnahes Fressen und die Leute Anschauungsunterricht bei der öffentlichen Zerlegung. Warum nun wegen einer toten Giraffe so ein Buhei gemacht wird, wo hundertausende Tiere ohne Namen täglich getötet werden, erschließt sich mir nicht. --TP12 (D) 18:16, 10. Feb. 2014 (CET)
Nein, das Problem war nicht "halt da". Das Problem ist entstanden, weil der Zoo untätig war. Woran das genau lag, ob das Gedankenlosigkeit oder schlicht Missachtung den Tieren gegenüber war, können wir hier nur spekulieren. Dass die Tiere sich paaren ist jedenfalls keine Weltneuheit. Dass das vorkommen kann, wusste der Zoo. Und damit, dass Giraffen Nachwuchs haben, hab ich ja gar kein Problem. Das liegt in deren Natur und ist völlig in Ordnung. Da hätte er sich halt vorher um die Unterbringung kümmern müssen oder notfalls, wenn es gar nicht anders geht, eben Maßnahmen ergreifen müssen, um die Fortpflanzung zu vermeiden. Aber erst tatenlos zuzusehen bis es zu spät ist und sie dann umzubringen, ist nicht in Ordnung. Ich kann ja auch nicht mit meinem Köter auf die Straße gehen und den abstechen, weil ich keinen Bock mehr auf ihn habe. Da kommen dann aber ganz schnell die Umwelt-, Tier- und sonstige Schützer und machen ein Riesenbohei drum. Und da reden wir noch nicht mal von einer vom Aussterben bedrohten Tierart, sondern nur von Kötern, wie es sie zu Millionen gibt. --88.130.67.161 19:17, 10. Feb. 2014 (CET)
Das darfst du in den meisten Ländern, aber selbstverständlich nicht abstechen sondern unter größtmöglicher Vermeidung von Schmerzen. In Deutschland gilt aber noch der Kuscheltierparagraph, der das Töten von Hund und Katze nur zu wissenschaftlichen Zwecken erlaubt. PοωερZDiskussion 19:30, 10. Feb. 2014 (CET)
Die Giraffe wurde doch an den Löwen verfüttert. Wäre die Giraffe nicht getötet worden, hätten die stattdessen irgend ein anderes Tier töten müssen um den Löwen zu füttern. Das kommt uns nur schade vor, weil für uns eine Giraffe halt ein exotisches Tier ist. Den tausend Kühen (oder sonstige Viecher) die der selbe Löwe schon gefressen hat, weint keiner eine Träne hinterher. --2003:66:8E38:1201:1025:85CD:3379:3CA2 17:52, 10. Feb. 2014 (CET)
Und in China essen sie Hunde. Nur ist hier halt nicht China. --88.130.67.161 18:00, 10. Feb. 2014 (CET)
Schade eigentlich. Hund ist bestimmt lecker. Marcus Cyron Reden 19:02, 10. Feb. 2014 (CET)
Nee, Hund ist ziemlich zäh. Das ist Armeleuteessen. Ich versteh den Aufstand auch nicht. Ein Tier wurde geschlachtet. Passiert millionenfach jeden Tag. Es wurde zu wissenschaftlichen Zwecken seziert. Schön. Löwen durften das Vieh essen. Auch schön. PοωερZDiskussion 19:10, 10. Feb. 2014 (CET)
In der Tat. (scnr)  ;-) Solaris3 (Diskussion) 19:11, 10. Feb. 2014 (CET)
Wenn ein Tier vor Laien, zum Großteil vor kleinen Kindern, die sich verstört abwenden, geschlachtet wird, wo da der "wissenschaftliche Sinn" sein soll, weißt du wahrscheinlich selber nicht. Das ist Sensationsgier. Bestenfalls. Genau wie bei den Körperwelten - nur dass da die Verarbeiteten das selbst so wollten. --88.130.67.161 19:23, 10. Feb. 2014 (CET)
Ich hingegen kann nicht nachvollziehen, wie man das Verfüttern von Fleisch an Kinder vertreten kann, wenn man den Kindern verheimlicht, woher das Zeugs eigentlich kommt, weil das verstört. Dann ist das Fleischessen an sich verstörend und gehört verboten; der Meinung bin ich aber nicht. PοωερZDiskussion 19:32, 10. Feb. 2014 (CET)
Oh Gott oh Gott, vor den Kindern wurde es geschlachtet. Tja, waren die Kinder da eingesperrt und wurden gezwungen da zuzusehen? PA entfernt. --88.130.67.161 23:43, 10. Feb. 2014 (CET) --mw (Diskussion) 22:59, 10. Feb. 2014 (CET)
Die absurde Behauptung, dass das Töten dieses gesunden Jungtiers aus wissenschaftlichen Zwecken nötig gewesen sei, ist nunmal gelinde gesagt ein Witz. Hätten sie das - wie andere Zoos auch - im Stillen und im Schutz der Dunkelheit gemacht hätten, hätte da nie jemand von erfahren. Aber so, das ist reine Sensationsgier. Bestenfalls. Genau wie bei den Körperwelten - nur dass da die Verarbeiteten das selbst so wollten.--88.130.67.161 23:43, 10. Feb. 2014 (CET)
Mal gesehen, wie Giraffenbullen kämpfen? Sterilisieren reicht da nicht. GEEZER… nil nisi bene 21:04, 10. Feb. 2014 (CET)

Ich bin selten auf der Seite von Tierschützern, aber bei Zoologischen Gärten teile ich die Kritik, daß es ein verlogenes System von Gutmenschen ist, die sich dort die Wahrheit nach eigenem Gusto und Gefühlslage zurechtbiegen. In der Diskussion werden völlig unterschiedliche Punkte vermischt - warum werden Tiere in Zoos gehalten? Zur Unterhaltung von Menschen? Dann hätte man dies Tier sicher irgendwo anders ausstellen können, egal was das für das Tier bedeutet. Die Alleinhaltung eines sterilisierten Bullen in einem anderen Park wäre auch nicht "artgerecht" gewesen, sondern hätte nur das Mitleid von Menschen befriedigt. Die Problematik, die in der laienhaften Berichterstattung untergeht, es gibt mindestens 9 verschiedene Unterarten von Giraffen, welche sich nicht miteinander vermehren sollen, da es bei derartigen Zuchtprogrammen ja gerade um die vorhandene Vielfalt geht. Der Kreis der möglichen anderen Zoos ist darum wesentlich kleiner, als die Gesamtzahl der Zoos mit Giraffenhaltung. Es ist auch in der Natur üblich, das ältere Bullen unbewußt ihren Nachwuchs schwängern, und auch in Kopenhagen war dies wohl auch artgerechter als man glaubt, wie dieser Bulle entstand. Mag es für das Tier auch tragisch geendet haben, aus Gründen der Zucht war es langfristig die richtige Entscheidung. Es ist nunmal so, daß zur Arterhaltung viel weniger Bullen als Kühe nötig sind, obwohl die Anzahl beider bei der Geburt etwa gleich ist. Darüber redet man nur ungern, ist aber bei fast jeder Tierart in menschlicher Haltung so, das selektiert wird.Oliver S.Y. (Diskussion) 21:23, 10. Feb. 2014 (CET)

Die Dänen haben nur nicht aufgepaßt, wie man das richtig macht. Als Eisbär Knut im Berliner Zoo nicht mehr so niedlich war, hatte er plötzlich, ups , einen Gehirntumor und war tot. Wo ist wohl dessen Leiche geblieben?--Optimum (Diskussion) 23:26, 10. Feb. 2014 (CET)
Für mich hört sich das zwischen den Zeilen so an, als wolltest du sagen, Knut habe keinen Gehirntumor gehabt. Sicher hast du auch reputable Quellen für diese Verschwörungstheorie? --88.130.67.161 23:43, 10. Feb. 2014 (CET)
Anderswo wird Eisbären gleich das richtige Futter verabreicht, um ein sozialverträgliches Frühableben zu gewährleisten. --Rôtkæppchen68 23:56, 10. Feb. 2014 (CET)
Ich würde meine Jacke nicht dafür opfern; ist doch kalt draußen und ich bin kein Eisbär! *brrr* --88.130.67.161 00:36, 11. Feb. 2014 (CET)
Die deutsche Schlachtordnung verbietet die Anwesenheit von Kindern unter 14 Jahren und "Unbefugten" beim Schlachten von Tieren. Zum Schlachten gehört meiner Meinung nach auch das Aufbrechen und Ausnehmen des Tieres. Insofern wäre das in Deutschland klar eine Ordnungswiedrigkeit gewesen. Aber wir haben den Kontakt zur Realität schon lange verloren. Yotwen (Diskussion) 07:18, 11. Feb. 2014 (CET)
Das "Schlachten" war eine Obduktion durch Mediziner, keine Zerlegung durch einen Fleischer. Das mit dem Realitätsverlust geht also noch viel weiter. Ansonsten war es, soweit ich weiß, auch einfach eine Platzfrage, wo diese Aktion stattfinden sollte, da ne Giraffe kein Standardmaß für Szeziertische hat. Wie diverse Zooexperten ja auch bestätigen, ein völlig normaler Vorgang, wie es Gazellen, Hirschen und Schweinen regelmäßig in Zoos passiert.Oliver S.Y. (Diskussion) 11:31, 11. Feb. 2014 (CET)
Wenn es sich um eine "Obduktion" gehandelt hat, dann war das Fleisch des Tieres mit "BU" (für Bakteriologische Untersuchung) zu qualifizieren und hätte nach der Futtermittelverordnung (Deutschland) nicht roh verfüttert werden dürfen (arme Löwen). Du glaubst doch nicht, dass wir in Deutschland noch ungestraft furzen dürfen? (Das dürfte der Bundesimmissionsschutzverordnung unterliegen). Und wenn du es als Fleischbeschau klassifizierst, die zwingend erforderlich wäre, dann gilt wieder das Anwesenheitsverbot für Kinder. Wie gesagt: Deutsches Recht. Über dänisches Recht weiss ich nichts. Yotwen (Diskussion) 12:36, 11. Feb. 2014 (CET)
Die Schlachtordnung verbietet die Anwesenheit von unter 14 Jährigen? Seit wann gibt es denn so was? Es gibt doch auch Fischerkurse für Kinder. Die lernen auch das Töten und Ausnehmen der Fische. Wenn die Mitarbeiter in dem Zoo klug sind, lesen Sie einfach drei Wochen keine Zeitung, dann ist die künstliche Aufregung um gar nichts wieder vorbei. --2003:66:8E38:1201:E8ED:23B5:1B28:ECDA 18:50, 11. Feb. 2014 (CET)
... verbietet die Anwesenheit von unter 14 Jährigen? Seit wann gibt es denn so was?“ Na vielleicht hat einfach mal jemand der Ahnung hat einen Beitrag geschrieben? Was sich wohltuend abhebt von all dem Meinungsgeschwurbel was in einer Auskunft nichts verloren hat. --84.178.34.20 07:29, 12. Feb. 2014 (CET)
Oder so geht es gleich im Viererpack. Bei gefährlichen Tieren kann man versehentlich einen Tierschützer ans Gehege lassen und dann auf Notwehr plädieren. Nur bei Giraffen wäre dieser Vorwand unglaubhaft. --Grip99 03:06, 14. Feb. 2014 (CET)
Vær's'go'. --Dansker 01:29, 13. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 02:07, 17. Feb. 2014 (CET)

Rechtsfrage: Informationspflicht des Vermieters

Ich habe ein Schreiben meines Vermieters erhalten, in welchem er eine Wohnungsbesichtigung ankündigt. Als Gründe dafür gibt er an, er habe Informationen, dass dies und das.
Diese Informationen sind jedoch eindeutig falsch. Ich vermute nun, dass diese Falschbehauptungen aus der Nachbarschaft kommen (ich habe sogar einen konkreten Verdacht).

  1. Muss der Vermieter auf meine Bitte/Aufforderung hin preisgeben, woher seine Informationen stammen?
  2. Könnte ich - da die Behauptungen nachweislich falsch sind - Strafanzeige wegen übler Nachrede bzw. Beleidigung stellen?

--™Go†h 14:46, 11. Feb. 2014 (CET)

Rechtshinweis Bitte den Hinweis zu Rechtsthemen beachten!

Beziehen sich die Informationen auf deine Person an sich, oder auf deine Verwendung/Behandlung der Wohnung? Ich vermute jetzt mal, dass du, wenn sich die Informationen auf dich beziehen und dich in Misskredit bringen, und sie nachweislich falsch sind, sehr wohl Anzeige wegen §§185, 186, 187 StGB stellen kannst. Und das würde ich auch mal tun, denn das sind Antragsdelikte, die nur auf Antrag des Opfers verfolgt werden. --Eu-151 (Diskussion) 16:37, 11. Feb. 2014 (CET)

Die "Informationen" beziehen sich auf die Behandlung bestimmter, genannter Einrichtungsgegenstände (angebl. dauerhaft gekipptes Fenster, Heizung angebl. dauerhaft auf Maximum, angebl. dauerhaft laufender Warmwasserhahn) und sind schlicht falsch/gelogen --™Go†h 16:41, 11. Feb. 2014 (CET)
Hm. Der Vermieter hat ein Recht auf eine angemeldete Begehung der Wohnung. Andererseits lassen sich die von die aufgezählten Sachverhalte nicht durch eine Begehung verifizieren. Irgendwie komisch. --84.191.135.120 17:14, 11. Feb. 2014 (CET)
Selbstverständlich lässt sich das nicht durch eine einfache Begehung verifizieren. Jetzt mal mir selbst unterstellt, die Vorwürfe stimmten, wäre es schließlich ein Einfaches, die Heizung runter zu drehen, das Fenster zu schließen und den Hahn zu zu drehen.
Trotz alledem werde ich morgen mal beim Vermieter aufschlagen, um heraus zu bekommen, von wem der Quatsch stammt. --™Go†h 17:18, 11. Feb. 2014 (CET)
Vielleicht noch: Der Würzburger Haus- und Grundbesitzerverein schreibt: "Liegt kein konkreter Anlass vor, hat der Vermieter grundsätzlich keinen Anspruch darauf, gegen den Willen des Mieters die Wohnung zu betreten und zu untersuchen (...) Routinekontrollen zur generellen Untersuchung der Wohnung auf ihren Allgemeinzustand und etwaige Mängel muss der Mieter nach den Grundsätzen von Treu und Glauben aber etwa alle ein bis zwei Jahre dulden. Aus dem Recht des Vermieters zu Routinekontrollen folgt jedoch keine Pflicht, die Mietsache ständig auf alle mehr oder weniger wahrscheinlichen Schadensmöglichkeiten zu untersuchen." --84.191.135.120 17:21, 11. Feb. 2014 (CET)
Danke für die Info --™Go†h 17:24, 11. Feb. 2014 (CET)

Es ist nicht verboten, den Wasserhahn dauerhaft laufen zu lassen oder die Heizung aufzudrehen. Es sind zu bezahlende Leistungen und der Anbieter hat sogar ein Interesse daran, möglichst viel abzugehmen. Man kann aber nachvollziehen, dass Dich solche Nachbarn stören. Bei mir zum Beispiel haben mal welche die Polizei angerufen und gesagt, sie hätten den verdacht dass mir "was passiert" ist, damit bei mir Polizisten vorbei kommen und nachsehen ob mir was passiert ist. Die anderen Leute im Haus denken dann, dass die Polizisten wegen was anderem gekommen sind. 2001:4C28:4000:721:185:26:182:25 22:16, 11. Feb. 2014 (CET)

Ein Vermieter hat das angeborene Bedürfnis sich ab und zu über den Zustand seines vermieteten Eigentums informieren zu wollen (das geht Autobesitzern genauso). Ein neuerer Trick, um Zugang zur Wohnung zu fordern (zumindest in Niedersachsen) ist die gesetzliche Pflicht zum Einbau von Feuermeldern in den vermieteten Wohnung und die Pflicht des Vermieters die Funktion der Feuermelder jährlich (!) überprüfen zu lassen (könnte er natürlich auch von einem externen Dienstleiser machen lassen). --Thirunavukkarasye-Raveendran (Diskussion) 23:35, 11. Feb. 2014 (CET)
Der Rauchmelderüberprüfer sieht dann aber nur den Flur mit dem Rauchmelder, den Rest der Wohnung muss man ihm nicht zeigen. Wenn bei mir der Wasser- oder Heizungsableser kommt, darf er nur den Flur und das Klo mit den Zählern sehen, mehr nicht. Zum Glück hab ich eine elektronische Heizenergieerfassung mit Kontaktwasserzähler und Temperaturfühlern und keine Verdunsterröhrchen in jedem Raum. Rauchmelderpflicht gibt es in Baden-Württemberg nicht. Ich habe meinen Rauchmelder wieder demontiert, weil ich kein Interesse hab, jedesmal darauf aufmerksam gemacht zu werden, wenn die Nachbarn wieder mal verbotenerweise im Treppenhaus rauchen. --Rôtkæppchen68 00:03, 12. Feb. 2014 (CET)
Halt, Stopp. Bis 31.12.14 müssen in alle Bestandswohnungen in BaWü Rauchwarnmelder eingebaut sein. Und zwar nicht nur im Flur, sondern auch in allen Schlafräumen. Siehe hier, falls der Link nicht tut, bitte nach Rauchwarnmelder suchen. Grüße Marcus (MKir_13) (Diskussion) 19:10, 13. Feb. 2014 (CET)
In manchen Häusern wird der Heiz- und Warmwasserenergieverbrauch nicht für jede Wohnung extra gemessen, sodnern nur fürs ganze Haus bestimmt und dann einfach nach einer bestimmten Formel auf die einzelnen Wohnungen aufgeteilt. Wenn da jemand das Warmwasser 24/7 laufen hat, steigen die Kosten für alle exorbitant. Daher kann ich mir nicht vorstellen, dass das in dem Fall legal ist. --MrBurns (Diskussion) 00:33, 12. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 02:07, 17. Feb. 2014 (CET)

Windows8

Hallo Bill Kunterbunt! Wie schalte ich meinen Computer aus, starte ihn neu, versetze ihn in Energiespar- oder Ruhezustand?????? --Frze > Disk 17:48, 11. Feb. 2014 (CET)

Mauszeiger nach rechts oben, dann Zahnscheibe/Settings, dann Bereitschaftssymbol/Power. Oder einmal auf den Desktophintergrund klicken und dann Alt+F4, wie seit Urzeiten. --Rôtkæppchen68 18:05, 11. Feb. 2014 (CET)
ClassicShell finde auch ich ganz hilfreich. IW 18:41, 11. Feb. 2014 (CET)
Juchhuh - danke! Endlich mal vernunftbegabte Leute - danke. (ALT+F4 hatte ich noch nie benutzt.) --Frze > Disk 18:54, 11. Feb. 2014 (CET)
Ich nutze auch Windows 8.1 und verzichte gänzlich auf diesen Metromist. Apps habe und brauche ich nicht. Mit Classic Shell kann man Windows dann mit insgesamt nur zwei Klicks runterfahren - genau wie seit eh und je. Gerüchten zufolge will Microsoft mit dem anstehenden Update für Windows 8.1 aber auch die Runterfahrfunktion in Metro zugänglicher machen; ich mein die soll dann oben rechts in dem Menü hinter dem Benutzernamen enthalten sein. Wenn das so wäre, fände ich das immer noch nicht wirklich gut, aber es wäre jedenfalls schonmal eine Verbesserung. --88.130.105.207 18:59, 11. Feb. 2014 (CET)
@Lidius[25] --Frze > Disk 19:47, 11. Feb. 2014 (CET)
Wer Windows 8 hat und von Modern UI genervt ist, braucht nicht auf 8.1 zu aktualisieren. Die Änderungen sind marginal, außerdem muss man sich mit Windows 8.1 zunächst zwingend mit einem Microsoft-Konto verbinden. Mein alter Rechner (hatte zuvor schon Vista und 7 drauf) ist kurze Zeit nach dem Update flöten gegangen, das muss nicht direkt damit zusammenhängen, jedoch fiel schon öfter auf, dass Acer-Computer ihre Probleme mit Windows 8 haben. Gerüchten zufolge soll mit Windows 9 die Desktop- von der Mobilwelt wieder stärker getrennt werden, sprich Wiederauferstehung des Startknopfes und Abschaffung der schwarzen Dingsbumsleiste, zumindest auf dem Desktop. IW 20:44, 11. Feb. 2014 (CET)
Hä, ja und? Willst du uns mit diesem Post sagen, dass man, wenn man von einem System genervt ist, man es einfach nicht aktualisieren sollte? Natürlich kriegt man dann Probleme. Aber hallo! Besser wird es dadurch sicher nicht! Und überhaupt: Inwiefern soll ihm der Hinweis auf Windows 9 helfen? "Lieber Frze, in einem Jahr, vielleicht auch erst in 1 1/2, wird Microsoft ein neues System veröffentlichen. Kauf dir das doch, dann kannst du runterfahren." Deine Antwort soll wohl ein schlechter Witz sein. --88.130.105.207 22:26, 11. Feb. 2014 (CET)
Jay Paulus (Director of Product Marketing) rät natürlich, nicht auf Windows 9 zu warten, sondern von XP auf eine moderne Microsoftplattform zu wechseln, sprich Windows 7 oder besser noch 8. Solch eine Antwort ist aber auch nicht verwunderlich.
Windows 8.1 hat übrigens wieder einen Startknopf. Damit geht dann diese unsinnige zweite Bedienoberfläche, also die Kacheln, auf (m. E. ist die einfach nur überladen und wohl eher für Touchscreens gedacht). Klickt man dort auf den Benutzer, kann man sich abmelden (warum nicht auch herunterfahren?).
P. S.: Ich kann Deine Frage übrigens vollkommen nachvollziehen, da ich bei der Erstbenutzung erst einmal die kleine Einführung zu Rate ziehen mußte, damit ich den PC herunterfahren konnte (Warum konnte man nicht einfach einen Knopf auf der Taskleiste integrieren?). Danach habe ich dann einfach Alt+F4 ausprobiert; seitdem schalte ich den Rechner nur noch so aus.--IP-Los (Diskussion) 22:49, 11. Feb. 2014 (CET)
Ergänzend zu Alt+F4 nutze ich auch gerne den Knopf vorne am Rechner zum Runterfahren. --Rôtkæppchen68 22:50, 11. Feb. 2014 (CET)
Danke.svg
Leute, Leute. Musste mir zwangsläufig ein Laptop zulegen, da der alte Rechner mit XP zusehends nervtötend stockte und mir am Ende den Internetzugang ganz verweigerte. Also notgedrungen Windows8 mitgekauft - und von dem ganzen bunten Kästelkram, den die jungen Juppie-Programmierer ja alle so dringend brauchen, erschlagen. Sukzessive deinstalliert - blieb die Frage: Wie ausschalten?? War das früher schon ulkig (START drücken, um zu beENDEn), ist es ja jetzt der Hammer: EINSTELLUNGEN! Ich will meinen Rechner doch nicht EINstellen, sondern AUS. Schwachsinn. Keine Wahloption vorhanden. Und ALT+F4 oder den Ausschaltknopf - nein, ich will doch gleich dort weiter machen, wo ich aufgehört habe. Wenn ich außer Haus gehe, dreh ich doch auch nicht alle Sicherungen raus. Die ClassicShell-Mannschaft hat wirklich Grips. Danke nochmal. --Frze > Disk 08:09, 12. Feb. 2014 (CET)

Taskleiste: Weiß jemand aus dem Hut, wie man die wieder schön blau färbt?? Die Uhrzeit, weiß auf hellgrau mit Wolken, na ja, Big Bills Enkel... Danke --Frze > Disk 08:31, 12. Feb. 2014 (CET)

Der Ausschaltknopf geriet wohl wegen dem Dauergeklicke in Vergessenheit. Die Einstellungen müssen stimmen. Der Knopf kann auch so konfiguriert werden dass der Computer in den 'Stromsparmodus' geht. Das hilft jenen die, wie oben erwähnt, dort weiter machen wollen wo sie aufgehört haben. Ganz runterfahren ist trotzdem ab und zu notwendig weil Windows nicht für den 7x24h Betrieb gemacht ist. Es gibt immer Prozesse welche mal hängen bleiben. Nur mit ganz runter- resp. wieder rauffahren kriegt man einen "sauberen" Start hin welcher aus den anderen Schlaf- Energiespar-Zuständen nicht möglich wäre. Weil man Windows nur über mehrere Klicks oder mit einem Tastendruck der sofort wirkt ausschalten kann habe ich mir ein Tool (PcOff.exe) programmiert welches Windows nach einem einfach zu unterbrechenden Countdown von 5s (parametrisierbar) runter fährt. Link im Schnellstart und Windows lässt sich mit einem Klick runterfahren. Dieses Tool verschenke ich meiner Kundschaft. Wikipedianer und ihre Freunde die das Tool haben möchten kriegen es auch. Es gibt einen direkten Link auf meiner Benutzerseite, unter Weblinks, wo man es sich runter ziehen kann. Wenn gewisse Browser eine Warnung anzeigen müsste man 'behalten' wählen um es zu kriegen. --Netpilots -Φ- 09:36, 12. Feb. 2014 (CET)

Methode 5. --195.36.120.125 10:31, 12. Feb. 2014 (CET)
Da fehlt Methode 6: Power-Button. Geht am schnellsten und es ist keinerlei Vorbereitung nötig. --Eike (Diskussion) 10:57, 12. Feb. 2014 (CET)
Windows 8/8.1 startet so fix, dass sich der Energiesparmodus gar nicht lohnt. Ich hab allerdings keinen Notebook, sondern einen Desktop mit Windows 8.1 und ich fahre den Rechner nach Gebrauch immer runter, der Stromrechnung zuliebe. Und ich nutze Steckdosenleisten, um meine PCs nach Gebrauch komplett auszuschalten. Das spart noch ein bisschen mehr. --Rôtkæppchen68 10:37, 12. Feb. 2014 (CET)
@Netpilots: "Nicht für Dauerbetrieb geeignet"? Nachdem mein XP hier auf dem Single-Core mit 500MB RAM 8 Minuten benötigte, um zu booten, hab ich den Ruhezustand wieder ausgegraben - und siehe: Mein Rekord liegt bei 42 Tagen, bevor ich versehentlich auf "Herunterfahren" geklickt habe. Tatsächlich gibt es manchmal Probleme mit dem Garbage-Collect, aber merkwürdigerweise sind die nicht von Dauer. Schwerwiegender ist, dass zahlreiche UpDate-Prüfungen (und mein Terminkalender) erst beim Booten so richtig aktiv werden... Ich möchte (und ich erschrecke, das aus meinen Fingern quellen zu sehen) allerdings mal einen Lanz (ähm...) für Win8 brechen: Auf 'nem Tablet (i.e: Surface Pro) läuft das richtig klasse und der Charme (wer denkt sich solche Namen aus??? Also: Die komische Leiste am rechten Bildrand) folgt meinem rechten Daumen aufs Wort... Aber wehe, ich hab die Maus angeschlossen und fahre damit 'nen Millimeter zu weit nach rechts - dorthin also, wo das Vollbild-Fenster seine ControlBoxes hat... Warum darf der Zauber nicht von unten - statt von der Seite - wachsen? Nicht angemeldet Bu63 89.0.139.98 11:19, 12. Feb. 2014 (CET)
Nach 7 Wochen, 17 Stunden, 2 Minuten, 47 Sekunden und 296 Millisekunden (232 Millisekunden) stürzen viele Windows-Programme von alleine ab, wegen Timerüberlauf. --Rôtkæppchen68 11:38, 12. Feb. 2014 (CET)
LOL - Das hast Du jetzt aber hoffentlich nicht extra ausgerechnet, oder!?? - Und: Welch ein Gewinn - bei Win95 gab es doch anfangs den Effekt, dass der Bildschirmschoner nicht über Mitternacht wandern durfte - oder so ähnlich... Wichtig für mich: Ich stelle sukzessive meine Hardware um und installiere Win8; der Lustgewinn überwiegt die Kosten, wenn das Einschalten tatsächlich wieder eine Sache von weniger als einer Minute ist; Laien empfehle ich gar den Kauf eines NEUEN Notebooks; was soll das Hantier mit Neu-Installation (für einen Laien, der dazu einen gutbezahlten Enkel braucht) eines Systems, dessen Lizenz etwa EUR 100,-- beträgt, wenn man Hardware incl. System für EUR 350,-- erhält. Andererseits (und damit nehme ich auch Stellung zu einem Post weiter unten) vor einigen Tagen habe ich einen Athlon-Single mit MSI-Mainboard (BJ etwa 2006) installiert; Für Windows8 war die Treiber-Situation besser, als sie für Windows7 je gewesen ist - und es läuft mit 2GB RAM. 'N bisschen, wie VW-Käfer ausgraben. was war das denn jetzt? Bu63 (Diskussion) 12:05, 12. Feb. 2014 (CET)
Das war gerüchteweise so um 1995 bei einigen wenigen Programmen der Fall. --A.Hellwig (Diskussion) 14:34, 12. Feb. 2014 (CET)
2^32 Millisekunden sind aber 17 Jahre, nicht 7 Wochen. --Grip99 03:30, 14. Feb. 2014 (CET)
4 Milliarden Millisekunden => 4 Millionen Sekunden => 71.500 Minuten => 1200 Stunden => 49 Tage => 7 Wochen --Eike (Diskussion) 08:39, 14. Feb. 2014 (CET)
Peinlich. Ich weiß nicht, was ich da gerechnet hatte. --Grip99 01:32, 17. Feb. 2014 (CET)
Und wie kriege ich meine weiße Taskleisten-Uhrzeit 11:30 auf blauem Grund nun wieder hin, auf dass ich sie erkenne? --Frze > Disk 11:29, 12. Feb. 2014 (CET)
Hab ich nie probiert, aber: Desktop mit rechts anklicken; "Anpassen"; in der "Anpassung" findet sich bei mir (Win8.0; Tablet-PC) unten ein Symbol "Farbe" - und das verspricht, die Farbe von Fensterrahmen und Taskleiste beeinflussen zu können; anscheinend müssen Änderungen explizit gespeichert werden, so dass man wohl experimentieren darf - - - oder zu Windows 98, der letzten Version mit guter Lesbarkeit, downgraden...Bu63 (Diskussion) 11:48, 12. Feb. 2014 (CET)
Danke - das war's. Am besten wieder zurück zur „Erika“? --Frze > Disk 12:47, 12. Feb. 2014 (CET)
Thanx for the Memories.jpg
Meine Erika hieß Olympia - und sorgte bei jedem Umzug erneut für ruinierte Bandscheiben - Dafür kam sie ohne "Druck"-Befehl aus :-) Bu63 (Diskussion) 12:57, 12. Feb. 2014 (CET)
Gerade durch Updates herausgefunden: "2922812 Shutdown time is longer when shutting down from the Start hint context menu in Windows 8.1". Man kann Win 8.1 auch noch beenden, indem man mit der rechten Maustaste aus den Startknopf drückt. In dem Menü erscheint dann "Herunterfahren oder abmelden" > "Herunterfahren". Allerdings sind das auch viele Schritte, um einfach zu beenden.--IP-Los (Diskussion) 17:38, 13. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 02:08, 17. Feb. 2014 (CET)

Warum ist das Wasser im Bodensee eigentlich nicht extrem hart?

Es fliesst immer Wasser nach, welches verdampft. Gelöste Bestandteile im Wasser verdampfen dabei nicht mit. --93.132.21.93 12:35, 13. Feb. 2014 (CET)

das meiste Wasser verdunstet nicht, sondern rinnt den Rhein runter bis Holland, während oben in den Bergen Regenwasser nachkommt. --El bes (Diskussion) 12:41, 13. Feb. 2014 (CET)
Es fließt auch Wasser über den Rhein ab. Außerdem definiert sich die Wasserhärte nicht durch den Gehalt beliebiger Salze, sondern im Wesentlichen durch den Gehalt an Carbonaten. Und dieser ist erheblich vom pH-Wert des Wassers abhängig. -- Janka (Diskussion) 12:43, 13. Feb. 2014 (CET)
Es hängt vom Gestein ab, aus welchem die Quellen kommen. Der Bodensee hat weiches Wasser, das von Millionen Menschen konsumiert wird.--Giftzwerg 88 (Diskussion) 12:53, 13. Feb. 2014 (CET)
Das Wasser kommt demnach also aus weichen Steinen? --91.0.171.78 14:55, 13. Feb. 2014 (CET)
Zu weichen Steinen siehe #Sind alle Stoffe semi-flüssig? :) --тнояsтеn 15:03, 13. Feb. 2014 (CET)
Wo kann sich Kalk anlagern? ;-) --Hans Haase (有问题吗) 20:16, 13. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 02:09, 17. Feb. 2014 (CET)

Lichtverlust durch Fenster

Wenn ich mit einem Luxmeter einmal direkt in die Sonne messe, erhalte ich 97000 Lumen, direkt hinter dem (geputzten) Fenster 74000 Lumen. Ist es möglich, dass ein sauberes Doppelglasfenster 25% des einfallenden Lichtes absorbiert? Zusatzfrage: Im Artikel Lichtquelle ist eine Tabelle, in der liest man, dass eine 1000W 230V Halogenglühlampe ca. 24200 Lux erzeugt. Wenn ich mit meinem Luxmeter direkt an das Schutzglas meiner 50W Halogen-Schreibtischlampe gehe, messe ich einen Lichstrom höher als 1.000.000 Lumen. --77.3.135.64 14:59, 12. Feb. 2014 (CET)

Vielleicht wurde das Fenster nicht ausreichend geputzt. Es kann sein, dass es trotzdem sauber ausschaut, 25% Lichtverliust kann das menshcliche Auge bei einer Lichtintensität wie sie bei tageslicht vorherrscht kaum wahrnehmen. Zu Luxmetger-direkt-an-das-Schutzglas der lampe halten: Das wird bei Halogenlampen nach dem Einschalten sehr schnell sehr heiß, das kann leicht dazu führen, dass das Luxmeter sich sofort über die maximal zulässige Betriebstemperatur erwärmt. Dann ist dem Messergebnis nicht mehrzu trauen, man muss dann auch froh sein, wenn das Messgerät keinen dauerhaften Schaden nimmt. --MrBurns (Diskussion) 15:24, 12. Feb. 2014 (CET)
Und kenne bitte den Unterschied zwischen Lux (Einheit) und Lumen (Einheit). --Rôtkæppchen68 15:29, 12. Feb. 2014 (CET)
Das Fenster absorbiert nicht einen Teil des Lichts, sondern *reflektiert* ihn. Das ist praktisch unvermeidlich, es sei denn, die Sonne scheint exakt senkrecht in das Fenster. -- Janka (Diskussion) 15:33, 12. Feb. 2014 (CET)
Es wird auch ein Teil absorbiert, weil es keine Stoffe gibt, die gar kein Licht absorbieren. Nur ist dieser Anteil im Vergleich zum reflektierten Anteil bei Glas wohl vernachlässigbar. --MrBurns (Diskussion) 15:39, 12. Feb. 2014 (CET)
Direkt in die Sonne gemessen, misst dein Messgerät auch ein wenig Ultraviolett. Glas ist für Ultraviolett relativ undurchlässig. D. h. die Helligkeit ändert sich nur wenig, aber die Energie, die das Messgerät misst, nimmt erheblich ab. Yotwen (Diskussion) 15:40, 12. Feb. 2014 (CET)
Heutige Thermofenster haben metallbeampfte Scheiben und eine gewisse grünlichgraue Tönung, die schon gewollt einen Teil des Lichts ausfiltern, v. a. Wärmestrahlung, zusätzlich zur Filterwirkung des Fensterglases. Für UV-Licht ist Glas ziemlich "schwarz" und UV-Licht ist der energiereichere Teil des Lichts, was sich deutlich im Messwert bemerkbar macht.--Giftzwerg 88 (Diskussion) 15:53, 12. Feb. 2014 (CET)
<klugscheißmodus>Eigentlich ist das gesamte sonnenlicht Wärmestrahlung und zwar mit einrr Farbtemperatur von ca. 5.500K.</klugscheißmodus> Bei den Thermofenstern gehts abe rwohl eher um die Wärmestrahlung, die von Ggenstäänden aus der Wohnung (inkl. Radiatoren) kommt, dabei handelt es sich (fast ausschließlich) um Infrarotlicht, slebst die herkömmlichen Glühlampen strahlen großteils im IR-Bereich (und diese Strahlung will man ja, wenns draußen kälter ist als drinnen, ebenfalls thermisch nutzen). --MrBurns (Diskussion) 16:10, 12. Feb. 2014 (CET)

Zusatzfrage. Wie misst man eigentlich korrekt die Helligkeit in einem Zimmer oder an einem Arbeitsplatz? Wenn ich mein Luxmeter in die Hand neheme, zeigt es wenn ich es in verschiedene Richtungen halte, völlig unterschiedliche Werte an. Zeige ich in Richtung meiner schwarzen Schreibtischunterlage wird nur ein zehntel dessen angezeigt, als wenn ich das Gerät in Richtung weiße Wand halte. Ich habe, drehe ich das Gerät an einem Sonnentag um 360 Grad auf Augenhöhe, zig unterschiedliche Werte. --77.3.135.64 19:43, 12. Feb. 2014 (CET)

Ich denke in Richtungd er Lichtquelle... --MrBurns (Diskussion) 21:18, 12. Feb. 2014 (CET)
Man legt oder hält das Luxmeter auf die zu messende Fläche, z.B. den Schreibtisch oder Fußboden. Die Messung muss mehrfach an verschiedenen Stellen, idealerweise in einem Raster, wiederholt werden, da übliche Lichtquellen einen Raum nicht vollkommen gleichmäßig ausleuchten. --Rôtkæppchen68 21:36, 12. Feb. 2014 (CET)
Ja, auf die zu messende Fläche, aber gemessen wird in Richtung der Lichtquelle (andersrum würde man wohl immer 0 messen, wenn mans direkt auf die Fläche legt). --MrBurns (Diskussion) 21:40, 12. Feb. 2014 (CET)
Nein, die Messrichtung ist senkrecht zur Messfläche, nicht zur Lichtquelle. Das gäbe verfälschte Ergebnisse. Außerdem hättest Du bei flächigen oder mehreren Lichtquellen ein Problem. --Rôtkæppchen68 22:30, 12. Feb. 2014 (CET)
Anwendungsbeispiel: hier wird die Bleuchtungsstärke der weißen (oder hellgrauen?) Unterlage gemessen --MrBurns (Diskussion) 02:06, 13. Feb. 2014 (CET)
Ich habe mich vielleicht zu ungenau ausgedrückt: mit "Richtung" meinte ich nur die generelle Richtung, nicht den genauen Winkel. Daher man hät den Sensor so, dass er von der Fläche wegzeigt, nicht auf die Fläche (also das Luxmeter liegt auf der Fläche, der Sensor zeigt aber von dieser weg). Das bezog sich darauf, dass die IP offensichtlich nicht die Beleuchtungsstärke der Flächen gemessen hat, sondern das reflektierte Licht. Dass der Winkel so zu wählen ist, dass die optische Achse (Messrichtung ist da auch ungenau, da der Messwinkel im Idealfall 180° beträgt) dabei senkrecht zur Messfläche stehen muss, ist nach der Definition der Beleuchtungsstärke natürlich klar. Wenn der Sensor so konstruiert ist, dass er Licht aus verschiedenen Winkeln einfängt (was wohl bei guten Luxmetern der Fall ist), dann sind dann flächige Lichtquellen oder mehrere Lichtquellen kein Problem. --MrBurns (Diskussion) 02:06, 13. Feb. 2014 (CET)
Verstehe ich nicht. Wie messe ich nun korrekt die Helligkeit in meinem Raum mit meinem Luxmeter? Wenn ich mich auf einer Achse auf 360 Grad drehe, habe ich 360 verschiedene Werte. Und das ist nur eine Achse wenn ich 1 Grad Auflösung zugrunde lege. Wenn ich mich in zwei Achsen bewege habe ich 130.000 Messpunkte. Ein bischen viel. --93.132.59.31 22:35, 14. Feb. 2014 (CET)
Du legst einfeach den Sensor bei jeder Fläche drauf. Dann misst der Sensor genau, wie stark diese Fläche beleuchtet wird. So wie auf dem Foto. --MrBurns (Diskussion) 00:49, 15. Feb. 2014 (CET)

derzeit höchste Bildauflösung in Pixeln pro Fläche

Wie hoch ist die derzeit höchste erhältliche Bildauflösung? Und wieviele Pixel hat die Realität? 2001:4C28:4000:721:185:26:182:25 22:57, 11. Feb. 2014 (CET)

Die Realität hat etwa 10^-10 m Auflösung (Durchmesser Atom). 213.54.7.243 23:08, 11. Feb. 2014 (CET)
Wieviel ist das in Pixeln und in welchem Jahr würden die Fernseher diese Auflösung überschreiten, falls die derzeitige Entwicklung geht so weiter ginge. 2001:4C28:4000:721:185:26:182:25 23:14, 11. Feb. 2014 (CET)
(BK) Zur ersten Frage: zu unspezifisch. bezieht sie sich auf Displays oder Bildsensoren? Letztere haben eine deutlich höhere Auflösung pro Fläche. Zur zweiten Frage: gar keine, ein Pixel ist ein picture element (Bildelement), die Realität kann also keine Pixel haben. In eine ähnliche Richtung (Zahl der Elemente) gehen aber folgende Zahlen aus dem Artikel en:Orders_of_magnitude_(numbers): 10^80-10^85 (Teilchenzahl des beobachtbaren Universums) und 4x10^185 (Zahl der Planck-Volumina des beobachtbaren Universums). @213.54.7.243: Es gibt aber noch kleinere Dinge als Atome, die Atome selber haben noch Strukturen. Ein sinnvolleres Maß wäre eher die Plancklänge von ca. 1,616x10^-35 m (eine kürzere Länge kann nicht gemessen werden und existiert daher im Sinne der modernen Philosophie nicht). --MrBurns (Diskussion) 23:15, 11. Feb. 2014 (CET)
Die gängigen physikalischen Theorien arbeiten nicht mit einer pixelartigen Aufteilung des Raumes. --Chricho ¹ ² ³ 23:27, 11. Feb. 2014 (CET)
Die Rechnung kann nicht stimmen, weil die Photonen auch nicht auf Planklängen-Dichte herum fliegen. Die Schätzung auf Basis von Atomlängen als kleinste Einheiten scheint eher geeignet. Wesentlich kleiner könnte man Leuchtpixel auf einem Bildschirm auch nicht bauen.2001:4C28:4000:721:185:26:182:25 23:30, 11. Feb. 2014 (CET)
Photonen sind Bosonen und können daher beliebig dicht beisammen sein. --MrBurns (Diskussion) 23:40, 11. Feb. 2014 (CET) PS: und darum, wie klein man "Leuchtpixel" bauen kann, gings ind er ursprünglichen Frage nicht. --MrBurns (Diskussion) 00:35, 12. Feb. 2014 (CET)
Deine Realität? Der Flaschenhals ist die Verarbeitung der Sinnesreize der Netzhaut im Neocortex. Dieses Netzwerk wird beim Menschen erst frühkindlich zusammengestöpselt, die tatsächliche Wahrnehmungsfähigkeit, sowohl was die maximale Bildauflösung als auch die Fähigkeit zum Unterscheiden von Helligkeits- und Farbwerten angeht ist daher in höchstem Maße individuell. Manche Menschen sehen so scharf wie ein Durchschnittsfalke. Siehe Sehschärfe. -- Janka (Diskussion) 12:10, 12. Feb. 2014 (CET)
Ich hab mal gelesen, dass das Auge ca. 200-300 Megapixel wahrnehmen kann, wobei man laut Stäbchen (Auge) "nur" ca. 120 Millionen Stäbchen hat (die Zahl der Zapfen ist im vergleich dazu vernachlässigbar), also ist bei 200-300 Millionen Pixel wohl mitgerechnet, dass man das Auge unbewusst bewegt, damit man nicht nur das kleine Gebiet des gelben Flecks hochauflösend wahrnehmen kann. Die kleinsten Punkte, die man noch als ausgedehnt wahrnehmen kann, düften im Durchschnitt bei ca. 0,1mm liegen, wobei des individuell verschieden ist. Jedenfalls hat mein Handy wohl eine Pixeldichte von 306 ppi,[26][27], was einer Pixelgröße von 25,4mm/306 ~ 0,083mm entspricht. Theoretisch sollte man die Pixel also nicht mehr einzeln wahrnehmen können, ich kanns aber trotzdem noch. Bei Fernsehern sind so kleine Pixel natürlich sinnlos, weil da sistzt man nicht so nah dran, die Winkelauflösung des menschlichen Auges ist laut Sehschärfe#Vergleichswerte im besten Fall 0,4 Winkelminuten, ich könnte ausrechnen, wie viel mm das z.B. auf 1m Abstand entspricht, aber dafür habe ich jetzt keine Zeit. Es steht jedenfalls auch "3 cm auf 100 m", wenn man das auf 1m hochrechnet, entspricht das 0,3mm, kleiner Pixel machen also bei einem TV-Gerät wohl wenig Sinn, weil näher dran als in 1m Entfernung sitzt man da ja wohl normalerweise nicht. --MrBurns (Diskussion) 13:11, 12. Feb. 2014 (CET)
Das Retina-Display ist noch etwas schärfer, womit Frage 1 des OP wohl endlich beantwortet ist. Mit einer Sehschärfe von 1,0 sollte man aus 17 cm Entfernung eine Auflösung von 50 µm haben (laut Freisichtigkeit ist u. U. sogar noch mehr drin), was kleiner ist als der Durchmesser der Retina-Display-Pixel mit 78 µm. Und ein Visus von 1,0 (20/20 nach Snellen) ist laut en:Retina Display#Criticism bestenfalls durchschnittlich. --Florian Blaschke (Diskussion) 22:24, 16. Feb. 2014 (CET)
Höhere Auflösung als Rasterelektronenmikroskope haben nur noch Teilchenbeschleuniger und Hubble. Die °kleinste° Wechselwirkung ist glaub´ zwischen Quarks. Von °Pixeln° kann man dann bei Wellenphänomenen wohl nicht mehr sprechen. Oder so ähnlich. Jenseits des (°kleinsten°) Informationsüberträgers Licht (elektromagnetische Strahlung) zur Abbildung der Realität gibt es derzeit nur Schlußfolgern. --217.84.64.195 17:38, 12. Feb. 2014 (CET)
Richtig ist: die "kleinste" bekannte Wechselwirking ist zwischen Quarks. Es ist nicht auszuschließen, dass man irgendwann herausfindet, das Quarks (und/oder Leptonen und/oder andere Teilchen) noch eine inner Struktur haben. Nur liegt anch den derzeitigen Modellen die absolute Untergezne eben bei ca. 1,616x10^-35 m. Und tatsächlich erzeilt man mit Elektronenmikroskopen derzeit eine höhere Auflösung als mit Mikroskopen, die Licht oder anderen EM-Wellen verwenden, was aber eher damit zu tun hat, wie an das Licht ausreichend vergrößern kann, um es aufzunehmen, als damit, wie "klein" die Photonen ansich sind. Die höchste Auflösung bei Messungen erzielt man aber derzeit mit Streuung, da aber auch nicht mit Photonen. --MrBurns (Diskussion) 17:53, 12. Feb. 2014 (CET)
Deine Handypixel kannst du wohl aber nur sehen, wenn du das Bild im Vergleich zur Sensorfläche vergrößerst. Die Pixel sind im Bereich von 10µm x 10µm oder noch kleiner. --mfb (Diskussion) 13:10, 13. Feb. 2014 (CET)
Ich meinte die Pixel vom Display, nicht vom Sensor. Die sind ca. 83µm x 83µm. --MrBurns (Diskussion) 19:09, 13. Feb. 2014 (CET)
@MrBurns: Was hat denn die Plancklänge nun mit Quarks und Leptonen zu tun? Diese Teilchen haben im Standardmodell schlicht überhaupt keine Ausdehnung. Und die Skala, auf der man die mit den derzeitigen Teilchenbeschleunigern auflösen kann, ist jedenfalls wesentlich ungenauer. --Chricho ¹ ² ³ 00:54, 14. Feb. 2014 (CET)
Dass diese Teilchen keine Ausdehung haben ist nur eine Annahme, die man deshalb tätigt, weil man bisher keien Ausdehnung festellen konnte. So wie man früher gedacht hat, dass neutrinos keine masse haben, weil man keien feststellen konnte. Letztere Annahme wurde mittlerweile falsifiziert.[28][29] Es könnte sich also auch irgendwann herausstellen, dass Leptonen und Quarks doch eine Ausdehnung oberhalb der Placnklänge haben (wenn die Heisenbergsche Unschärferelation udn die allgemeine Relativitätstheorie stimmt ist es wohl unmöglich zu überprüfen, ob ein Teilchen keine Ausdehnung oder eine Ausdehung unter der Placnklänge hat, das gilt auch für die meisten (oder sogar alle?) Quantengravitationstheorien, nur postulieren einige andere Werte für die Plancklänge). mit DErzeitigen Messungen zur Ausdehnung ist man aber noch sehr weit von der Plancklänge entfernt, laut en:Point particle und der dortigen Quelle weiß man vom Elektron derzeit nur, dass die Ausdehnung unter 10^-18 m liegt, ich nehme mal an bei den anderen sog. Elementarteilchen wirds ählich sein. --MrBurns (Diskussion) 01:33, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:42, 17. Feb. 2014 (CET)

Verschlüsselung des PC

Ich habe hier ein Windows PC und eine Backupplatte, auf die jeden Tag automatisch Backups geschrieben werden mittels eines üblichen Backupprogrammes. Wenn ich meinen PC incl. Backupplatte verschlüssele, kann ich beim wiederherstellen über das mitgelieferte Wiederherstellungstool (Ein kleines Linux zum booten) nicht mehr auf die Backupdaten sinnvoll zugreifen. Lasse ich die Backupplatte von der Verschlüsselung aus, kann ich es auch ganz bleiben lassen. Was könnte die Lösung sein? --77.3.135.64 20:01, 12. Feb. 2014 (CET)

Du könntest mit GnuPG verschlüsseln, dann kannst du auch mit Linux wieder entschlüsseln (nicht vergessen, Kopien des Schlüssels aufzubewahren!). Wie praktisch sich das in dein tägliches Backup (Respekt!) einfügt, kann ich dir aber nicht sagen...
TrueCrypt ist auch nicht schlecht. --Jack User (Diskussion) 21:40, 12. Feb. 2014 (CET)
Was soll man dazu sagen, wenn man das Toll nicht kennt und auch nicht weiß, wie du die Platten verschlüsselt hast? An sicht sollte das ja kein Problem sein – wenn du per LUKS eine Partition auf der Platte verschlüsselst, kannst du die ja ganz normal wie jede andere Partition verwenden. Grüße --Chricho ¹ ² ³ 21:43, 12. Feb. 2014 (CET)
Ich verschlüssele momentan täglich im laufenden Betrieb anhand Ocster Backup Pro. --93.132.21.93 13:52, 13. Feb. 2014 (CET)
Truecrypt gibt es sowohl für Windows und Linux und dieses Programm stellt deswegen eine Ausnahme unter den Verschlüsselungsprogrammen dar. Installation ist jeweils sehr leicht (Shellskript, exe-Datei). Du kannst es von deren Homepage kostenlos und ohne Registrierung runterladen. Dieses Programm wird allgemein bei plattformübergreifenden Verschlüsselungen empfohlen. LUKS funktioniert nur bei Linux gut und ist nicht wirklich kompatibel zu Windows (ist es das überhaupt?). Du kannst aber auch dein Windows (z.B. mit truecrypt vollverschlüsseln) und die Backups durch das Backup-Programm selber verschlüsseln lassen (bei Kaufprogrammen geht das meistens). Bist du umzingelt von Feinden? Dann ausschließlich Truecrypt verwenden (ist aber auf Dauer sehr lästig) -- 80.226.24.4 15:50, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:42, 17. Feb. 2014 (CET)

Wann ist der Wendepunkt beim Naseschneuzen?

Hallo, es ist ja seit Jahren bekannt, dass man besser die Nase hochzieht, als sie zu schneuzen, da man damit den Rotz, pardon, das Sputum, in die Nebenhöhlen drückt. Jetzt meinte aber unser Kinderarzt, dass kleine Kinder noch keine Nebenhöhlen besitzen, sondern nur Ausbuchtungen vorhanden sind, die später erst zu Nebenhöhlen werden. Man kann Kindern also gut und gerne ganz klassisch die Nase putzen. Meine Frage aber: Wann findet der Wechsel statt? Ab wann lieber ein "Zieh Dir die Nase hoch mein Kind" als ein Schneuzen ins Taschentuch? Rolz-reus (Diskussion) 11:39, 13. Feb. 2014 (CET)

sowas hab ich noch nie gehört(dass hochziehen besser wäre) dann wäre niesen ja auch schädlich. was für ein ... --217.251.202.16 22:15, 13. Feb. 2014 (CET)
Wenn es nicht nur auf die Gesundheit, sondern auch auf die soziale Verträglichkeit ankommt, vielleicht besser nie? Sonst heißt es irgendwann: Spiel nicht mit den Schnuddelkindern! ;-) --Hermine Tuzzi (Diskussion) 11:51, 13. Feb. 2014 (CET)
Die Gesunheit unserer Kinder geht nicht vor?!? Ich find die Vorstellung spannend, dass Kindern in Zukunft das Hochziehen beigebracht werden könnte... --Eike (Diskussion) 11:57, 13. Feb. 2014 (CET)
Das ist keine Zukunftsmusik, das findet schon längst statt. Und besser bringt man es den Kindern von Anfang an bei als sie später, wenn sich die Nebenhöhlen ausgebildet haben, wieder umzuerziehen. Das Hochziehen klingt in altmodisch erzogenen Ohren zwar sehr gewöhnungsbedürftig, aber die Akzeptanz dürfte langsam zunehmen. Und das Schneuzen in Taschentücher ist ja auch oft mit sehr angenehmen Geräuschen verbunden - ganz zu schweigen von den hochinfektiösen Rotzfahnen, die dann irgendwo rumfliegen, und den Keimen, die über die Hände (Händeschütteln, Türklinken etc.) verbreitet werden. Der Weg ist noch weit, aber er hat schon begonnen.
Die Eingangsfrage beantwortet wohl unser Artikel Nasennebenhöhle. --Snevern 12:52, 13. Feb. 2014 (CET)
Und warum soll es sinnvoll sein, das Sputum in die Nebenhöhlen zu drücken? Förderung von Nebenhöhlenentzündungen oder was? --Jossi (Diskussion) 10:57, 14. Feb. 2014 (CET)
Es ist nicht sinnvoll, das Sputum in die Nebenhöhle zu drücken. Genau das tut man aber beim Nase schneuzen. Beim Hochziehen dagegen passiert das nicht. --Snevern 17:50, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:42, 17. Feb. 2014 (CET)

Fantastische Vier (Comic, 1970er)

Hallo, ich suche nach den Inhaltsangaben der einzelnen Comics (der Ausgaben von Williams-Verlag aus den 1970ern). Wäre super, wenn sich jemand melden würde. Danke --217.251.202.16 14:15, 13. Feb. 2014 (CET)

Einstieg hier ... dann nach vorne und hinten durchklicken. It's clickering time !!! GEEZER… nil nisi bene 14:26, 13. Feb. 2014 (CET)
Danke für die schnelle Antwort. Ich suchte aber etwas auf deutsch.--217.251.202.16 14:30, 13. Feb. 2014 (CET)
Ja ... dann sorry. Google-Translator hilft bei dieser Thematik nicht wirklich weiter:
"Dies kombiniert mit der Human Torch mit den Hänseleien und der Tatsache, dass sie bringen auch das Unmögliche Mann zurück auf die Erde bekommt Ben wütend. Als das Schiff sie Pilotierung werden beginnt, auf die Erde mit einer schnellen Geschwindigkeit fahren. Bei dem Versuch, den Bruch zu packen, Ben unterschätzt seine Kräfte und bricht es macht das Schiff auch weiterhin auf die Erde zu beschleunigen."
 :-) SUCHERMAN… nil nisi bene 08:12, 14. Feb. 2014 (CET)

Ja, der Google Übersetzer ist immer für lustige Ergebnisse gut. --79.224.201.214 11:56, 15. Feb. 2014 (CET)

Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:43, 17. Feb. 2014 (CET)

Autobatterie

Wie kann man die Autobatterie einfach definieren? --95.116.51.196 16:33, 13. Feb. 2014 (CET)

Autobatterie? Bleiakkumulator? Starterbatterie? --Heimschützenzentrum (?) 16:39, 13. Feb. 2014 (CET)
Steht (etwas verschwurbelter als hier) im Artikel Autobatterie: Die Autobatterie ist ein Akkumulator, der den elektrischen Strom für den Anlasser eines Verbrennungsmotors liefert. Solaris3 (Diskussion) 16:51, 13. Feb. 2014 (CET)
Das ist falsch, auf jeden unvollständig: Die Batterie liefert unter anderem den Strom für den Anlasser, aber sie hat noch andere Funktionen; zum Beispiel speichert sie die von der Lichtmaschine gelieferte Energie und speist damit zahlreiche andere elektrische Verbraucher, vom Licht über das Radio und den Fensterheber, die Hupe etceterapepe. --Snevern 16:54, 13. Feb. 2014 (CET)
Bitte zwischen Autobatterie als Starterbatterie und Traktionsbatterie unterscheiden. Hybridfahrzeuge haben einen effektiveren Generator als die konventionelle Lichtmaschine. Von der gespeicherten Energie in der Traktionsbatterie wird der Verbrennungsmotor gestartet. Der Anlasser entfällt damit. Die 12-V-Bordbatterie fällt dann sehr klein aus, da sie nur das Bordnetz, Licht und Heckscheibenheizung bedienen muss. Sie muss nicht so große Ströme wie eine Starterbatterie liefern. --Hans Haase (有问题吗) 20:05, 13. Feb. 2014 (CET)
Von Elektro- oder Hybridautos war doch bislang gar nicht die Rede...? Die Definition in unserem Artikel ist aber so oder so unvollständig, denn sie trifft weder auf die Batterie im herkömmlichen Verbrennungsmotor-Auto noch auf die im Hybrid-Fahrzeug zu. --Snevern 21:33, 13. Feb. 2014 (CET)
@Snevern: Du hast Recht, dass meine Definition oben (bewusst) unvollständig war. Ich hatte das weggelassen, weil bei heutigen Autos (groß dimensionierte Lichtmaschine) die Batterie eigentlich nur noch in Ausnahmefällen Strom liefert: 1. Natürlich wenn der Motor aus, aber Verbraucher eingeschaltet sind und 2. wenn der Motor im Leerlauf oder knapp drüber dreht, aber viele "Großverbraucher" eingeschaltet sind (Fahrlicht, Heckscheibenheizung etc). In allen anderen Fällen, also (außer im Stau) zu 99 + x % der Motorlaufzeit, liefert mE allein die Lichtmaschine den Strom und die Batterie dient maximal als "Stromglätter" bzw wird aufgeladen. Da Autos auch bei alleinigem Stop-and-Go-Betrieb im Winter normalerweise nicht nach drei Tagen mit leerer Batterie liegenbleiben, ist anzunehmen, dass moderne LiMas so dimensioniert sind, dass selbst bei Leerlauf die Batterie nur in Extremfällen (sehr hoher Stromverbrauch) einspringen muss. Gehört aber natürlich korrekterweise mitgenannt. Solaris3 (Diskussion) 18:59, 14. Feb. 2014 (CET)
Ich bin kein Kfz-Mechaniker, und meine Schraubertage sind lange vorbei. Vermutlich ist mein Wissen schlicht veraltet. --Snevern 20:34, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:43, 17. Feb. 2014 (CET)

optimale Ausrichtung Solarzelle

Wie müsste eine Solarzelle am 21. Juni am Zeitpunkt des höchsten Sonnenstands eine Solarzelle am Ort mit 50 ° nördl. Breite optimal ausgerichtet sein, um den maximalen Ertrag zu bekommen? Am Äquator (0° nördl. Breite) wohl im Winkel zu 23,5 ° wegen Neigung der Erdachse. Aber wie berechnet man es davon abweichend? --80.237.155.61 18:51, 13. Feb. 2014 (CET)

Was meinst du genau mit "maximaler Ertrag"? Mittags am 21. Juni (dann 26.5° gegen den Zenit, nämlich 90°−b+23.5°)? Über den ganzen 21. Juni (dann ist die Rechnung schwieriger, die Zelle muesste jedenfalls etwas steiler sein)? Über's Jahr hinweg (dann sollte die Zelle wohl immer zum Himmelsäquator zeigen, etwas steiler vielleicht, wenn man den niedrigeren Sonnenstand vor- und nachmittags berücksichtigt)? --Wrongfilter ... 19:17, 13. Feb. 2014 (CET)
gibt's dafür nich was Automatisches? das die in beiden(?) Rotationsachsen(?) ständig optimal ausrichtet? [30] --Heimschützenzentrum (?) 19:53, 13. Feb. 2014 (CET)
Es gibt Heliostaten. Wenn ich so etwas machen würde, würde ich die Nachführung anhand des tatsächlichen Sonnenstandes machen und nicht oder nicht nur nach den astronomischen Daten. --Rôtkæppchen68 23:07, 13. Feb. 2014 (CET)
Hint: Solartracker sind wohl gesucht. --mw (Diskussion) 08:48, 14. Feb. 2014 (CET)
Wobei die aber nur die tageszeitliche Änderung ausgleichen, nicht aber die jahreszeitliche. --FGodard||± 14:08, 14. Feb. 2014 (CET)
Bist Du da ganz sicher? Tageszeitlich würde ja heissen, sie drehen sich mit dem täglichen Sonnelauf mit, jahreszeitlich, sie drehen sich mit und passen die Neigung an, oder? Und genau solche, die sich jahreszeitlich anpassen habe ich hier quasi vor der Haustür stehen. --mw (Diskussion) 14:37, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:43, 17. Feb. 2014 (CET)

Herkunftsngabe von Meeresfrüchten

Vorhin habe ich heute aus Faulheit eine tiefgekühlte Paella gekauft, natürlich u.a. mit Garnelen. Bislang stand bei Garnelen immer dabei, wo die herkommen (Fanggebiet) und ob es sozusagen Wildtiere sind oder aus einer Aquakultur stammen (in Deutschland verkauft). Nun bei diesem Produkt von Norma stand gar nichts dazu. Ist das eine freiwillige Angabe oder Pflicht? Ich als kritischer Verbraucher denke gleich mal an üble Aquakultur. --77.4.64.118 19:31, 13. Feb. 2014 (CET)

Wenn nichts drauf steht oder wenn es bei Norma verkauft wurde, ist es immer aus Aquakultur. 46.115.130.204 20:38, 13. Feb. 2014 (CET)
Bei Fisch und Fischereierzeugnissen muss die Herkunft und die Methode der Erzeugung auf dem Etikett ersichtlich sein. Auf der hier genannten Paellaverpackung war dies nun nicht angegeben, weil es sich hierbei um ein bereits verarbeitetes bzw. zubereitetes Produkt handelt. Wie auch bei Marinaden oder Salaten muss die Herkunft und die Erzeugungsmethode der Garnelen nicht aufgedruckt sein. Mit Sicherheit lässt sich also nicht aus der Abwesenheit der Beschriftung folgern, dass die Garnelen aus Aquakulturen stammen. --TP12 (D) 21:03, 13. Feb. 2014 (CET)
Bei industriell hergestellten Lebensmitteln kannst Du davon ausgehen, dass jeweils die günstigste Variante verwendet wird, ohne Rücksicht auf Tier, Umwelt und Gesundheit. --Rôtkæppchen68 23:03, 13. Feb. 2014 (CET)
Im Zweifel ist das immer die billigste Variante, dabei ist es völlig wurst wie es produziert wird, hauptsache billig. In jedem annderen Fall würde der Hersteller voller Stolz das draufschreiben.--Giftzwerg 88 (Diskussion) 00:55, 14. Feb. 2014 (CET)

Wow, immer wieder toll, was hier mancher zu den Nahrungsmitteln meint, welche der Großteil der Bevölkerung verzehrt. Was die "üble Aquakultur" angeht, ohne diese könnten sich viele Menschen manche Lebensmittel gar nicht, oder nicht im gewohnten Umfang mehr leisten. Und das, obwohl es ihnen offenbar schmeckt, und sie bewußt auf diese vermeintlich preiswerteren Produkte zurückgreifen. Was das "günstig" angeht, beschäftigt Euch vieleicht mal selbst genauer mit Lebensmitteln, obwohl ihr schon ein Urteil habt. In der Frostapaella sind 11% gegarte Meeresfrüchte drin, wobei dabei interessanterweise sogar das Trinkwasser mitgewogen wird, die Tiere können also nur 9 oder 8 Prozent ausmachen, ohne das sich es ein Verbraucher merkt. Höchstens, das es in der Pfanne viel weniger wirkt. Nun ist Wasser produktionsbedingt immer dabei, nur wieviel, das wäre vieleicht zu hinterfragen. Anderes Problem, die Frostapaella hat einen Nährwert von 112kcal je 100 Gramm, Gut&Günstig 104, die Aldipaella gibt nur 95kcal, wieviel die Norma gibt, weiß ich nicht, aber auch das vieleicht eher ein Grund zu hinterfragen, wieso man 15 Pronzent weniger Inhaltstoffe akzeptiert, achso, die Paella wird vieleicht auch deshalb bei Aldi nur 85% kosten. Weiter, bei GuG sind 1,8 Gramm Fett enthalten, bei Aldi 2,6 bei Frosta 4 Gramm.... Könnte man sich also fragen, warum bei einer ähnlichen Rezeptur solch gravierende Unterschiede bestehen... Vieleicht mehr Meeresfrüchte drin, vieleicht aber auch einfach mehr Hartfett mit dazugegeben, weil das preiswert ist, und man so unbemerkt Geld sparen kann. Es sind also keinesfalls immer die "günstigsten" Varianten von Zutaten enthalten, manchmal besteht der Unterschied vor allem im Verhältnis der Zutaten, vom Teuren weniger, vom Rest mehr, und das Ganze so aufgebläht, das der Kunde es schwerer bemerkt, und möglichst nicht vergleichbar sein. Frosta 500g, Aldi und GuG 750g, wer hat wirklich schonmal auf die Kennzeichnung im Regal geschaut, wieviel 100 Gramm von beiden Produkten kosten? Also ich will hier nicht immer der Verteidiger der Lebensmittelindustrie sein, aber Ihr regt Euch mit gesundem Halbwissen über Probleme auf, die gar keine sind. Genauso ist nicht die Frage bei einem Fertiggericht, ob Wildfang oder Aquakultur. Die Frage ist eher, ob Kaltwasser oder Warmwassergarnele, welches Kaliber die Tiere haben, und welche Qualität verwendet wird. Grob gesagt, 1.Qualität, also ganze ausgewachsene Körper wirst in keinem TK-Gericht finden. Eher bei Frosta die 2.Qualität, grober Bruch und zu kleine Tiere, während beim Discounter der Restbruch drin landet. Es sind aber alles die selben Tiere, vom selben Fang, nur eben in unterschiedlicher Qualität. Das es auch 3.Qualität in unterschiedlichen Preisstufen gibt, keine Frage, aber das hat eher was mit Fangzeiten, Angebot und Verträgen zu tun. Und 11% von 500 Gramm für 3 Euro.... das sind selbst beim Markenprodukt 6,60 je Kilo "Meeresfrüchte"... "Riesengarnelenschwänze King Prawn" kosten bei GuG 11,50 das Kilo, auch daran kann man leicht erkennen, daß es nicht allein die Aquakultur ist, welche den Inhalt dieser Tüten zum Geheimnis macht.Oliver S.Y. (Diskussion) 01:40, 14. Feb. 2014 (CET)

Ekelerregend, was manche Leute weil es „offenbar schmeckt“ in sich reinstopfen (trotz detailiertem Wissen). --84.178.1.202 05:30, 14. Feb. 2014 (CET)
Jepp - wenn man schon billig essen will, sollte man es selbst kochen^^, damit man zumindest weiß, was man selbst für einen Dreck reingegeben hat. Wobei die Ansichten ja auseinandergehen, was Ursache und Wirkung ist. Die simpelste Lösung, einfach solche Importprodukte zu meiden will ja niemand wirklich umsetzen. Beispiel Kliesche, ein sehr häufiger Speisefisch, aber nicht besonders große Filets und grätenreich. Ist ja auch einer der Gründe für den Erfolg der Garnelen, die Menschen wollen "Meeresgeschmack" in Reinform, Haut, Gräten, Schuppen - sowas wird ihnen systematisch als Abfall beigebracht, und darum wohl der Ekel anerzogen durch die gesamte Gesellschaft. Heute ist Freitag, viele essen Fisch, nur wer hat wirklich einen ganzen Fisch oder ein erkennbares Teil davon vor sich? Bei mir gibts Scholle^^.Oliver S.Y. (Diskussion) 11:33, 14. Feb. 2014 (CET)
Jepp. Wenn man die Preisfrage aufmachen will, dann sind solche Fertiggerichte überteuert im vergleich zu einem entsprechenden Gericht, wenn man es selber kocht und dabei "mittlere" Qualität verwendet. z. B. kriegst du Fischfilets tiefgekühlt zwischen 5 und 10 Euro/kg je nach Sorte. Nimm Zwiebeln, eine Zehe Knoblauch und etwas gewürfeltes Gemüse, Reis, zusammen mit einem hochwertigen Speiseöl, dazu ein Fischfilet und du hast für wenig Geld ein hochwertiges Essen, es kostet nur zusätzlich die Mühe der Zubereitung. Du kannst die Zusammensetzung selbst bestimmen und der Anteil an Fisch oder Meeresfrüchte am Gesamtgewicht läge bei meiner Rezeptur bei ca. 30-40% statt bei 10%. Für dieses hochwertige Essen würdest du ca. 1,5-2 Euro pro Nase ausgeben, wobei der Fisch das teurste ist und die übrigen Zutaten nur ca. 50 ct kosten würden. Abgesehen davon zahlst du kein Geld für tiefgekühltes Wasser, das z.B. in dem gekochten Reis und in der "Glasur" der Schrimps enthalten ist. --Giftzwerg 88 (Diskussion) 16:19, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:44, 17. Feb. 2014 (CET)

Dissertationsdatenbank

Ehe ich mich durch drölfzig Metaseiten wurschtle, hat jemand nen Link für sone DAtenbank parat? Ich suche die Dissertation einr Juliane Lanz, habe die leise Hoffnung, das die online ist.--scif (Diskussion) 19:31, 13. Feb. 2014 (CET)

'Ne deutsche Dissertation? Dann versuch's doch mal unter portal.dnb.de. --Snevern 19:43, 13. Feb. 2014 (CET)
Hier findest du mal ein paar Details. Dir größte Chance auf ein Digitalisat hast du wenn du an der Promotionsuni suchst. U. U. musst du aber einen Bibliothekszugang haben, um die zu lesen.--Giftzwerg 88 (Diskussion) 19:47, 13. Feb. 2014 (CET)
Die Uni Marburg hatte zumindest letztes Jahr noch ein Dissertationenverzeichnis online -- das scheint es leider nicht mehr zu geben. --Hermine Tuzzi (Diskussion) 19:57, 13. Feb. 2014 (CET)
Das Inhaltsverzeichnis als PDF (100 kb, download). --Pp.paul.4 (Diskussion) 20:02, 13. Feb. 2014 (CET)
also die SUB Göttingen kennt keine „Lanz, Juliane“, aber eine „Lanz, Anna-Lisa“... [31]... meine Stationsärzte tauchen da alle auf... --Heimschützenzentrum (?) 20:26, 13. Feb. 2014 (CET)

Rostock! http://www.bpb.de/geschichte/zeitgeschichte/deutschlandarchiv/139965/olympia-zwischen-sport-und-politik?p=all --Vsop (Diskussion) 23:37, 13. Feb. 2014 (CET)

Meine Hochschulbibliothek kennt die Dissertation (Link). Der Link zum "digitalen Objekt" funktioniert aber (temporär?) leider nicht. ISBN ist 978-3-86573-626-0. --FGodard||± 23:47, 13. Feb. 2014 (CET)

Der Link zum "digitalen Objekt" beinhaltet auch nur das Inhaltsverzeichnis. --Komischn (Diskussion) 11:06, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:44, 17. Feb. 2014 (CET)

Helft kräftig mit, ihr Genossen!

Hi, Genossen und regelmäßige Auskünftler! (Auch Konservative, Liberale, Grüne,... sind angesprochen...)

Ich benötige Mithilfe beim Erweitern des {{Dejà-vu|https://de.wikipedia.org/wiki/Benutzer:Grey_Geezer/Geezers_D%C3%A9j%C3%A0-vu#Popul.C3.A4r-Astrophysik_.28alles_zum_Urknall.2C_Universum.2C_Raumschiffen.2C_Lichtgeschwindigkeiten.2C_Planck-Einheiten.2C_Zeit_und_Raum.2C_Hyperr.C3.A4umen.2C....29]]s, und wenn es genügend erweitert wurde, dann im Intro verlinken!

Ihr könnt auch weitere Themenbereiche auflisten, bessere Titel finden, usw... --Eu-151 (Diskussion) 23:00, 13. Feb. 2014 (CET)


--Eu-151 (Diskussion) 23:00, 13. Feb. 2014 (CET)

Nicht nur verlinken ... sondern erst als Unterseite verschieben => https://de.wikipedia.org/wiki/Wikipedia:Auskunft-FAQ <= oder so - dann verlinken... GEEZER… nil nisi bene 07:58, 14. Feb. 2014 (CET)

Ich habe mal die Seite https://de.wikipedia.org/wiki/Wikipedia:Auskunft/FAQ angelegt.--Optimum (Diskussion) 11:05, 14. Feb. 2014 (CET)

Hmmm ... Verschieben wäre "einfacher" gewesen. GEEZER… nil nisi bene 11:42, 14. Feb. 2014 (CET)
Wie kann man denn abschnittsweise verschieben??? Wenn das besser ist, machen wir meins wieder weg.--Optimum (Diskussion) 11:50, 14. Feb. 2014 (CET)
Ich war mal mutig. :o) --Eike (Diskussion) 12:10, 14. Feb. 2014 (CET)
gibt es einen Zähler(?) für diverse Begriffe. Wenn nein, wieso nicht? --80.108.60.158 12:15, 14. Feb. 2014 (CET)
Wow. Wenn das so gemeint war, dann ist das wirklich besser! --Optimum (Diskussion) 13:11, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:45, 17. Feb. 2014 (CET)

Darf sich ein promovierter assistant professor (USA) in Deutschland "Prof. Dr." nennen?

Ich nehme an, dass die Antwort auf meine Frage bereits gesetzlich geregelt oder gerichtlich entschieden ist. 85.179.141.158 07:16, 14. Feb. 2014 (CET)

Es gab vor einigen Jahren an der Friedrich-Schiller-Universität Jena einen derartigen Fall. Wenn ich mich recht erinnere, hat das Gericht "nein" gesagt. --91.178.151.241 07:37, 14. Feb. 2014 (CET)
+1 zu Nein GEEZER… nil nisi bene 07:52, 14. Feb. 2014 (CET)
+2 zu Nein --46.115.131.91 08:37, 14. Feb. 2014 (CET)
aus unbelegtProfessur#Vergleich_mit_Deutschland.2C_der_Schweiz_und_den_USA: Beim US-Begriff des „Assistant Professor“ muss unterschieden werden zwischen Stellen mit oder ohne „tenure-track“. Wenn es eine Stelle ohne „tenure-track“ ist, entspricht der Assistant Professor am ehesten einem promovierten Universitätsassistenten in Österreich oder einem Juniorprofessor in Deutschland. Wenn es sich um eine Stelle mit „tenure-track“ handelt, ist sie im Status etwas über dem deutschen Juniorprofessor anzusiedeln. Der Assistant Professor hat in der Regel seine eigenen Doktoranden sowie Mitarbeiter und besitzt auch Stimmrecht im Fakultätsrat. Im Vergleich zum deutschen Juniorprofessor hat er zudem ein höheres Maß an Selbstständigkeit bei der Akquisition von Forschungsmitteln und eine größere Unabhängigkeit in der Lehre. --Asteroidenbergbauer (Diskussion) 09:20, 14. Feb. 2014 (CET)
Sagen wir das so? Dann halte ich es nicht für komplett korrekt.
  • Assistant professor: An introductory level professor. A position generally taken after receiving a PhD and completing a post-doctoral fellowship. After 4–8 years, assistant professors will be either tenured or dismissed from the university.
  • Educators who hold a formal title of "Professor" (referred to as tenured/tenure-track faculty) typically begin their careers as assistant professors, (or "lecturers" and "senior lecturers") with subsequent promotions to the ranks of associate professor .... There is often a strict timeline for application for promotion from assistant to associate professor, most often 5 or 6 years following the initial appointment.
Also: Solange Karl-Heinz Assistant Professor ist, steckt er in der Maloch-und-Hoffe-Schleife - und bis er das sein wird, was in D unter Prof. verstanden wird, gibt es sinnvollerweise Blut, Schweiss und Tränen. It's lonly at the top. GEEZER… nil nisi bene 09:34, 14. Feb. 2014 (CET)

Man sollte alles im Original führen wenn man die Genehmigung vom KuMi erhalten hat, also z.B. Peter Müller, Ph.D (Univ. of Maryland oder USA), Ass. Prof. Univ, (Pennsylvania State-University) --G-Michel-Hürth (Diskussion) 14:51, 14. Feb. 2014 (CET) ehemals AAA U-Köln.

Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:47, 17. Feb. 2014 (CET)

Unterschiede bei Datenaustausch / XML/XDR

Hi! Wenn zwei Programme Daten austauschen sollen, wieso sollte man sich da für XML entscheiden? Besonders wenn das Schema (oder wie das heißt) auch noch so grotten albern ist (Bsp.: „<quatsch1111>Homer</quatsch1111>“ wassn „quatsch1111“? LOL)... und was haben alle gegen Nassi-Shneiderman-Diagramme/Struktogramme? die tauchen in UML gar nich auf, obwohl man die viel schöner für Aktivitätsdiagramme verwenden könnte... oder? Thx. Bye. --Heimschützenzentrum (?) 07:54, 14. Feb. 2014 (CET)

Watt für 'ne Qualitätsfrage... *seufz* Also, das heißt "Schema", und das findet sich sicher auch unter XML. Vorteile von XML sind zum Beispiel, dass es für Menschen - besonders, wenn das Schema gut gemacht ist - gut lesbar und auch editierbar ist und dass man mit einem XML-Tool (wie XMLSpy) sehr gute Unterstützung beim Editieren bekommen kann. Außerdem kann man den Nachteil, die Größe solcher Dokumente, gut ausgleichen, weil man durch das Schema sichergestellt hat, dass man ein starres Konstrukt hat, das man dementsprechend binärkodieren kann. Und man kann mithilfe der Validierung eine Prüfung des Inhalts vollautomatisch machen. Wenn ein Schema "grotten albern" ist, ist das sicherlich nicht XML anzulasten. --Eike (Diskussion) 08:30, 14. Feb. 2014 (CET)
hätt' man nich lieber n XDRSpy als XMLSpy schreiben können, damit ich keine neue Abkürzung lernen muss? oder irre ich mich irgendwie bei der Mächtigkeit der beiden (XDR/XML)? hört sich (bis auf die Menschenlesbarkeit vllt) gleich an für mich (man kann n XDR Schema sogar auch als XDR notieren...)... --Heimschützenzentrum (?) 08:49, 14. Feb. 2014 (CET)
Das scheinen schon sehr unterschiedliche Dinge zu sein. Ich kenne XDR nicht, und im Artikel taucht XML auch nicht auf. Das sieht aber aus als wär es zum Übertragen von einfachen Datentypen. Das ist nicht das Ziel von XML. Lies dir mal irgendeine XML-Grundlagen-Seite durch. Das sollte man als technikinteressierter Mensch schon kennen, finde ich. --Eike (Diskussion) 08:54, 14. Feb. 2014 (CET)
XDR kennt „Structure“... ich denke als technikinteressierter Mensch sollte man schon versuchen, das Rad nich dauernd wieder mit neuen Ecken neuzuerfinden, sondern mal voran zu kommen, sonst muss ich noch um meine Rente bangen... --Heimschützenzentrum (?) 09:23, 14. Feb. 2014 (CET)
XDR und XML sind komplett unterschiedliche Sachen. XML hat sich durchgesetzt, was sich IMHO nicht mit Mode o. ä. erklären lässt. Ob XDR auch tolle Sachen macht, kann ich nicht beurteilen, das hör ich heute zum ersten Mal. Hast du jetzt konkrete Fragen dazu oder wolltest du's nur einfach mal ("mit Nichtwissen", wie der Jurist sagen würde) doof finden? --Eike (Diskussion) 10:05, 14. Feb. 2014 (CET)
ich wollte wenigstens einen guten Grund lesen, weswegen sich XDR auf einmal nich mehr zum Daten-Austauch zwischen 2 Progis eignen soll... denn genau dafür ist XDR da und genau dafür wird XML in der Praxis verwendet (na klar darfst du XML weiter benutzen, wenn du menschenlesbar... ähm... jetzt weiß ich wirklich nich, wozu du es außer zur IPC brauchst...)... musst aber nix sagen, wenn du es nich weißt... LOL --Heimschützenzentrum (?) 10:24, 14. Feb. 2014 (CET)
Sorry, bevor du nicht ein kleines bisschen gelesen hast, macht das hier keinen Sinn. Ich kann dir gerne erklären, warum es zum Beispiel ein Vorteil ist, dass XML menschenlesbar und -änderbar ist - aber ich hab dazu keinerlei Lust, wenn du lieber über deine uninformierten Urteile rumLOLst statt mal eine Frage zu stellen (die nicht von vorneherein das Urteil enthält). --Eike (Diskussion) 10:32, 14. Feb. 2014 (CET)
ich wollte wenigstens einen guten Grund lesen, weswegen sich die Musikkassette auf einmal nich mehr zum Musik-Austauch zwischen 2 Schülern eignen soll... denn genau dafür ist die Kassette da und genau dafür wird MP3 in der Praxis verwendet (na klar darfst du MP3 weiter benutzen, wenn du anhörbar... ähm... jetzt weiß ich wirklich nich, wozu du es außer zum Datenaustausch brauchst...)... musst aber nix sagen, wenn du es nich weißt... LOL --Eike (Diskussion) 10:42, 14. Feb. 2014 (CET)
„XDR und XML sind komplett unterschiedliche Sachen.“, „Ob XDR auch tolle Sachen macht, kann ich nicht beurteilen, das hör ich heute zum ersten Mal.“... später ist dann „MC zu MP3” wie „XDR zu XML”... *staun* was dann nun? ich erkenne gerade bei der Größe sogar Vorteile bei XDR... auch n XDR browser/editor wär kein Problem... also hatte ich wohl immer recht, dass da Wirtschaftswissenschaftler meine Arbeit gemacht haben... *supi* ich lass es aber noch n paar Tage stehen, falls jemand einen eventuellen Irrtum aufzeigen kann... --Heimschützenzentrum (?) 10:54, 14. Feb. 2014 (CET)
Ich habe einen total tollen Trick angewandt, um grundlegende Informationen über XDR einzuholen: Ich habe die Wikipedia genutzt. Daher kann ich es ein Stück weit mit XML vergleichen, auch wenn ich es heute zum ersten Mal gehört habe, aber selbstverständlich noch nicht seine Bedeutung für die Computerwelt ermessen. Wenn du dasselbe für XML getan hättest, wäre uns die Frage ("Schema (oder wie das heißt)") vermutlich komplett erspart geblieben. (Es steht schon in der Einleitung des Artikels, dass es Schema heißt.) --Eike (Diskussion) 11:00, 14. Feb. 2014 (CET)
1. welche Frage? war mehr n Stilmittel, um mich über diese Großtuerei lustig zu machen... 2. warum schreibst du dann, dass XDR und XML „komplett unterschiedliche Sachen” sind, ohne wenigstens einen Unterschied hinzuschreiben? und bitte nich Menschenlesbarkeit. oder war das bevor du dich informiert hast? wie nennt n Jurist sowas? (<-- das is ne Frage) 3. das soll also alles gewesen sein? niemand anderes? --Heimschützenzentrum (?) 14:02, 14. Feb. 2014 (CET)
Ich schreibe die Unterschiede nicht hin, weil offensichtlich ist, dass du zu faul bist, die entsprechenden Artikel zu lesen (wie von der Einleitung dieser Seite gefordert). --Eike (Diskussion) 14:33, 14. Feb. 2014 (CET)
im XML Artikel steht z B.: „[...] hierarchisch strukturierter Daten [...] plattform- und implementationsunabhängigen Austausch von Daten zwischen Computersystemen eingesetzt[...].”... du schreibst als Zweites XDR könne sowas gar nich und als Erstes beantwortest du ne Frage, die ich gar nich gestellt habe... ich vermute daher, dass du meine Frage aus emotionalen/monetären, aber nich aus fachlichen Gründen so komisch „beantwortest“... sowas brauch ich nich wirklich... :-) --Heimschützenzentrum (?) 15:03, 14. Feb. 2014 (CET)
Ja, du hast Recht. XML ist überflüssig. Es wird nur von uns Wirtschaftswissenschaftlern in Zusammenarbeit mit deiner Vermieterin propagiert, damit die Weltwirtschaft zusammenbricht und deine Rente nicht fließt. Du hast das große Geheimnis aufgedeckt. --Eike (Diskussion) 15:08, 14. Feb. 2014 (CET)
hab ich ja gleich gesagt... da dachten noch alle es wär ne Wahnvorstellung... deine Ausflüchte waren aber mal was anderes als die bisherigen Versuche... tuhuh! :) --Heimschützenzentrum (?) 15:23, 14. Feb. 2014 (CET)

erledigt|Du konntest eine Information in Wikipedia trotz Benutzung von Suchfunktion der Wikipedia, einer Suchmaschine und des Archivs dieser Seite (Suchfeld unten) nicht finden? --Eike (Diskussion) 15:08, 14. Feb. 2014 (CET)

lass es! ;-) --Heimschützenzentrum (?) 15:23, 14. Feb. 2014 (CET)
@Eike: die Vermieterin gibts offenbar nicht mehr, jetzt muss isch Homer mit mehreren Stationsärzten herumschlagen (siehe weiter oben Dissertationsdatenbank) --TheRunnerUp 17:12, 14. Feb. 2014 (CET)

gibt's denn keine wirkliche Antwort? --Heimschützenzentrum (?) 05:03, 15. Feb. 2014 (CET)

Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:48, 17. Feb. 2014 (CET)

CD-Verkäufe

Hallo, kennt jemand eine Seite auf der man CD-Verkäufe (Alben, Singles) teilweise nachverfolgen kann? Ich frage mich nämlich woher man in manchen Artikel an die Verkaufszahlen kommt. Die Plattenfirmen dürfen, soweit man mir das mitgeteilt hat, diese Zahlen publik machen. --Goroth Stalken 10:46, 14. Feb. 2014 (CET)

Die Frage hatte ich letzte Woche gestellt. Antwort: Es gibt KEINE (offiziellen, nachprüfbaren) Zahlen. Alle irgendwo genannten Angaben sind Schätzungen.--Wikiseidank (Diskussion) 17:01, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:49, 17. Feb. 2014 (CET)

Unterschied Ereignis und Bestandsmasse

Hallo,

Für eine Statstik Klausur muss ich den Unterschied zwischen Bestands- und Ereignismasse verstehen, Wer kann mir eine einfach Erklärung mit seinen eigenen Worten liefern? --11:00, 14. Feb. 2014 (CET) (ohne Benutzername signierter Beitrag von 212.201.31.24 (Diskussion))

Ereignismasse
Bewegungsmasse, Ereignisgesamtheit, Ereignismasse; in der Statistik Bezeichnung für eine Gesamtheit, deren Abgrenzung durch Festlegung eines Zeitraumes erfolgt.[32]
Bestandsmasse
in der Statistik Bezeichnung für eine Gesamtheit, deren Abgrenzung durch Festlegung eines Zeitpunktes erfolgt.[33]
Fettung von mir. --Rôtkæppchen68 12:42, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:49, 17. Feb. 2014 (CET)

Arbeitsrechtliche Frage

Hallo liebe Autoren; ich habe eine arbeitsrechtliche Frage. Ich habe meine Ausbildung zum Industriekaufmann im August abgeschlosen, wurde aber aus wirtschaftlichen Gründen nur in ein Arbeitsverhältnis bis zum 31.12.2013 übernommen. Nun sehe ich, dass unsere Muttergesellschaft (selber Standort) genau einen Industriekaufmann in Vollzeit sucht (exakt selbe Tätigkeiten wie ich ausgeführt habe). Genau jener Chef, der entschieden hat, ich könne aus finanziellen Gründen nicht weiter beschäftigt werden, sucht nun seit einigen Wochen einen Angestellten. Frage: Ist das zulässig? Soweit ich weiß, müssen Stellen erst intern besetzt werden, bevor sie ausgeschrieben werden. Vielen Dank im Vorfeld und Grüße aus Ludwigsburg --92.230.142.48 11:03, 14. Feb. 2014 (CET)

That depends on: Gibt es einen Betriebsrat, der interne Ausschreibungen verlangt hat? Wenn es einen Betriebsrat gibt, erkundige dich bei dem, wie die Überordnungs-/Unterordnungsverhältnisse aussehen. Bewirb dich auf jeden Fall. Wenn deine Bewerbung abgelehnt wird, könntest du prüfen lassen, zum Beispiel vom Arbeitsgericht, ob die Ablehnung wirksam war. Mitgliedschaft in einer Gewerkschaft ist immer sinnvoll, auch dort wird man beraten. Sie kann auch Rechtschutz gewähren.
Rechtshinweis Bitte den Hinweis zu Rechtsthemen beachten!

(nicht signierter Beitrag von 79.204.207.145 (Diskussion) 11:12, 14. Feb. 2014 (CET))

Betriebsrat hat jedenfalls die Tochterfirma, bei jener ich angestellt war. --92.230.142.48 11:52, 14. Feb. 2014 (CET)

Ich glaube hier geraten mehr als ein Aspekt durcheinander. Und wie immer, Aufsuchen eines Fachanwalts oder anderer Rechtsberatung dringend zu empfehlen. Ansonsten hast Du einen befristeten Arbeitsvertrag mit Unternehmen A gehabt, Unternehmen B schreibt eine Stelle aus. Das ist ja gerade das Ziel von Ausgliederungen, das man als Unternehmer flexibel ist. Und ich kann mich wie so oft irren, aber bei Internen Ausschreibungen gelten auch Zugangsbeschränkungen, da intern ja meistens nur eine Versetzung beinhaltet, und keine neue Stelle, vor allem wenn wie hier diese Tätigkeit nicht ununterbrochen vergeben wurde. Oliver S.Y. (Diskussion) 12:21, 14. Feb. 2014 (CET)

Nur zur Info: Die Ausschreibung wurde lt. Webseite der Agentur für Arbeit am 19.11.2013 erstellt, also als ich noch nihteinmal wusste, dass es keine Vertragsverlängerung gibt. --92.230.142.48 12:32, 14. Feb. 2014 (CET)
Hat man auch Angestellten gekündigt? Vielleicht warst du ja ein Bauernopfer, um einer Klage aufgrund der Sozialauswahl vorzubeugen ...--176.199.5.106 14:11, 14. Feb. 2014 (CET)

Gefeuert wurde niemand. Nur mein Vertrag lief wie oben beschrieben aus.--92.230.142.48 19:05, 14. Feb. 2014 (CET)

Dein befristeter Vertrag lief vor über sechs Wochen aus. Zu diesem Zeitpunkt lief bereits die Ausschreibung für eine Stelle in einem anderen Unternehmen. Und jetzt willst du über die Auskunft der Wikipedia in Erfahrung bringen, ob du da noch was machen kannst? Das ist ein untauglicher Versuch.
Es gibt keine gesetzliche Verpflichtung, Stellen intern auszuschreiben, bevor man extern jemanden sucht. Schon gar nicht gibt es so eine Pflicht, konzernweit intern auszuschreiben. Und wenn es im konkreten Fall doch sowas gibt, dann muss das der Betriebsrat des suchenden Betriebs wissen, denn vermutlich wurde es dann mit ihm vereinbart. Der Betriebsrat versteht sich allerdings in der Regel nicht als Interessenvertreter des einzelnen Arbeitnehmers, sondern vielmehr als Vertreter der Interessen der Belegschaft insgesamt. Für dich als ehemaligen Mitarbeiter eines Tochterunternehmens wird er sich daher vermutlich überhaupt nicht zuständig fühlen; zumindest musst du damit rechnen.
Da du vermutlich weder Gewerkschaftsmitglied bist noch eine Arbeitsrechtsschutzversicherung hast, kannst du Geld in eine Erstberatung bei einem von dir umfassend über die Einzelheiten des Falls informierten Anwalt investieren. Oder, möglicherweise sinnvoller, dich auf die ausgeschriebene oder irgendeine andere deiner Qualifikation entsprechende Stelle bewerben. Viel Glück dabei wünscht --Snevern 19:51, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:49, 17. Feb. 2014 (CET)

Zitat gesucht.

Ich suche nach einem Zitat bzw Ausspruch, der sinngemäß ungefähr lautet: "In Zeiten des Irrsinns sitzen die Besten eines Landes im Gefängnis (oder auch: sind im Exil), während die Verbrecher die Regierung stellen." Weiß jemand Autor und genauen Wortlaut? Solaris3 (Diskussion) 12:18, 14. Feb. 2014 (CET)

Ich habe vage in Erinnerung, dass in der Tante Jolesch jemand meint, er (oder jemand anderer) müsse ins Irrenhaus und Dollfuß sei an der Regierung, umgekehrt wäre es aber besser. Dürfte zu 70% ein Zitat von Hugo Sperber sein. --KnightMove (Diskussion) 14:32, 14. Feb. 2014 (CET)
"Räuber, Mörder, Kindsverderber..." Gr., redNoise (Diskussion) 19:09, 14. Feb. 2014 (CET)
Sinnähnlich [34]. --80.108.60.158 18:02, 14. Feb. 2014 (CET)
Danke für die Tipps, kam allerdings nix so richtig ran, am ehesten noch der Dullfeet. Solaris3 (Diskussion) 13:03, 17. Feb. 2014 (CET)
Ähnlich auch noch: “Under a government which imprisons any unjustly, the true place for a just man is also a prison.” Henry David Thoreau, Civil Disobedience (1849). --Jossi (Diskussion) 10:55, 18. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:50, 17. Feb. 2014 (CET)

Frachtstatistik Sewmorput

Ich suche Statistiken über die jährliche Frachtmenge auf der Nordostpassage. Für 2012 (1260 tausend t), 2011 (820) und 2010 (110) habe ich Daten. Davor aber leider gar nichts. --kopiersperre (Diskussion) 13:51, 14. Feb. 2014 (CET)

Keine direkte Antwort, mehr ein Denkanstoß: Gibt es irgendwo auf der Strecke Stellen, auf die in Staat Einfluss nimmt, z.B. weil sie in seiner 12-Meilen-Zone liegen? Werden irgendwo auf dem Weg Zölle erhoben? Gibt es den einen Start- oder Zielhafen? Gibt es einen anderen Grund, weshalb man zählen können wollte, was durchgeht? Bei einem Kanal würde ich da z.B. an Schleusen denken... Das alles könnte einen Anhaltspunkt für die Menge transportierter Güter geben. --88.130.111.148 13:57, 14. Feb. 2014 (CET)
Die Glawsewmorput führt ganz sicher seit 1932 Statistiken. Bloß kann ich kein Russisch.--kopiersperre (Diskussion) 14:00, 14. Feb. 2014 (CET)
Das heißt dir würde ein Benutzer helfen, der ein bisschen Russisch spricht und mal auf der Seite dieser ru:Главное_управление_Северного_морского_пути schaut, ob die dazu Infos veröffentlichen. --88.130.111.148 14:05, 14. Feb. 2014 (CET)
Ein bisschen Russisch kann ich auch. Ich habe gerade morflot.ru angeschrieben.--kopiersperre (Diskussion) 14:20, 14. Feb. 2014 (CET)

Also interpoliere mal die Daten in Richtung Vergangenheit. Das geht doch dann ghanz einfach gegen Null. Viel kann da nicht gewesen sein. So weit ich mich erinnere war die offene Passage seiner Zeit eine besondere Neuigkeit.--G-Michel-Hürth (Diskussion) 16:25, 14. Feb. 2014 (CET)

Eben nicht. Vor dem Zusammenbruch der Sowjetunion wurde auf der wasserstraße das Mehrfache an Fracht wie heute transportiert. Bloß weiß ich nicht mehr, wo ich das gelesen habe. Indiz dafür sind die Bevölkerungszahlen der Häfen Dikson, Tiksi, Pewek und Prowidenija.--kopiersperre (Diskussion) 20:30, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:50, 17. Feb. 2014 (CET)

Gästebucheintag

--91.37.131.183 14:41, 14. Feb. 2014 (CET) ich möchte jemanden ein bild ins Gästebuch schicken mit den code und was schrifliches eingeben funktioniert aber mit bildern nicht

Auf welcher Website? --Eike (Diskussion) 14:46, 14. Feb. 2014 (CET)
Vermutlich will der Fragesteller auf einer Benutzerseite einen Text mit Bildern per Copy+Paste einfügen. Bilder lassen sich auf diese Weise Bilder in Wikipedia nicht einfügen. Dazu müsstest du dich anmelden, ein Bild als Datei hochladen und dieses oder ein anderes bereits hochgeladenes könntest du mit dem entsprechenden Wikicode auf der Seite einbauen. Falls es das ist, was du willst, solltest du dich auf der Seite WP:Fragen von Neulingen melden wo man die Details besprechen kann.--Giftzwerg 88 (Diskussion) 16:29, 14. Feb. 2014 (CET)
Falls das Bild auf Wikipedia oder Commons bereits vorhanden ist, kann es auch mittel [[Datei:dateiname.jpg]] oder [[File:filename.jpg]] eingebunden werden. Weiteres siehe Hilfe:Bilder. --Rôtkæppchen68 16:56, 14. Feb. 2014 (CET)
"Gästebuch" ist echt süß, wär ich nie drauf gekommen. Nur, seine 'Gäste' kann man sich normalerweise aussuchen ;-) in der WP aber nicht. Solaris3 (Diskussion) 18:33, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:50, 17. Feb. 2014 (CET)

Übersetzungsproblem bei der Beschreibung einer Fischfalle

Ich habe gerade mit der Übersetzung eines Buchs aus dem 19. Jh. zu tun. Gelegentlich wirds technisch und dann schwierig.

Hier die beschreibung einer Fischfalle:

A frame between two and three feet square is made, and of a greater or less height, according to the depth of water. Boards or slats are nailed on three sides of this frame, not so closely, however, as to prevent the water circulating freely through it. A door is fitted into the fourth side, in such manner that it will slide easily up and down in the grooves cut in the two posts. A movable bottom is then so fitted that it can be raised to the top of the frame without difficulty. In the centre of the movable bottom an auger hole is bored, and into this one end of a handle or round stick is fastened on the under side so loosely that it will turn. The handle ascends from the centre of the movable bottom to the top of the frame, or as much higher as is desirable. Up and down this handle, in a great many places, are gimlet holes, through which small sticks are inserted, extending to opposite sides of the frame. So many of these small sticks are running out from the handle in all directions, that a fish of any considerable dimensions cannot pass through without hitting one of them. The frame is then placed in the water and made stationary.
The trap is "set" by sliding or drawing up the door, and kept in that position by another stick, one end of which rests in a notch on the inner side, the other end in a notch made in the handle, running up from the centre of the movable bottom. The trap is baited by rolling a handful of wet meal and cotton together until it becomes hard, and depositing it in the back part of the frame. A fish swimming through the upraised door towards the bait, necessarily strikes one of the small sticks turning the handle, which dis placing the stick supporting the door, the latter falls, securing the fish within the frame. Taking hold of the top of the handle, the movable bottom is then drawn up to the surface of the water, and the fish taken out.

Wie um Himmels Willen übersetzt man das so, dass es halbwegs vorstellbar wird? Ich habe das Ding noch nicht vor Augen. Rainer Z ... 18:01, 14. Feb. 2014 (CET)

Könnte grob etwa so sein: Stell dir eine kubische (=gleichseitige) Kiste vor, mit geöffnetem Deckel wie bei einer Truhe. Der Deckel ist durch einen Stock abgestützt/wird offengehalten, der Stock ist unten in der Mitte des quadratischen Bodens lose befestigt und ragt senkrecht nach oben (an seinem oberen Ende liegt der Deckel auf). Der Stock hat lauter kleine 'Querstöcke' entlang seines Verlaufs, die jeweils quer durch die Kiste laufen, jedoch kreuz und quer in verschiedenen Höhen, so dass es - von oben gesehen - wie ein Stern (etwa so: *), aber mit sehr vielen 'Ästen' aussieht. Wenn der Fisch von oben in die Kiste reinschwimmt (auf der Suche nach dem unten innen angebrachten Köder) stößt er an eines der vielen Querhölzer und bewegt so den zentralen Stützstab. Der Deckel ist so labil auf dem Stützstab gelagert, dass durch diese kleine Bewegung der Deckel vom Stab rutscht und der Deckel zufällt (wobei das obere Ende des Stabs zB durch eine Öffnung im Deckel gleitet). Fisch ist drin, Klappe zu. Tatsächlich ist bei der Abstützung noch ein Extra-Stab beteiligt, aber das ist etwas vage beschrieben, wie der genau verläuft. Solaris3 (Diskussion) 21:02, 14. Feb. 2014 (CET) (PS: Ah, die Öffnung geht eigentlich zur Seite, daher der zusätzliche Stab "nach oben" zum Deckelhalten - der Stützstab bzw. 'Auslösestab' verläuft wohl waagrecht. Also meine obige Kiste gedanklich 90 Grad drehen, so dass die Öffnung zur Seite gerichtet ist). Solaris3 (Diskussion) 21:04, 14. Feb. 2014 (CET)
Ich verstehe das so, dass die Kiste oben keinen Deckel hat, sondern oben offen ist, mit einer Höhe mindestens entsprechend der Gewässertiefe. Drei Seiten sind wasser-, aber nicht fischdurchlässig, die vierte Seite besteht aus einer leichtgängigen Verschluss-"Tür", die in vertikalen Nuten der Eckpfosten läuft (wie amerikanische Schiebefenster). Diese Fallwand wird von einem Stützstäbchen oben gehalten, das seinerseits labil gegen den zentralen (drehbaren) Stab abgestützt ist. Der Fisch berührt die Querstäbe im zentralen Stab, dreht dadurch diesen und löst so den Fallverschluss aus. Anhand des zentralen Stabes wird der bewegliche Boden mitsamt dem Fisch nach oben gezogen. --Zerolevel (Diskussion) 21:23, 14. Feb. 2014 (CET) PS @ Solaris: Mit einem horizontalen Auslösestab klappt das nicht, IMO muss das Stäbchen mindestens 45 ° steil nach oben stehen, sonst fällt es sofort und nicht erst bei Fischkontakt. ––Zerolevel (Diskussion) 21:27, 14. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 19:51, 17. Feb. 2014 (CET)

Trägheitsfusion mit Lasern

Im September und November 2013 gelang es am National Ignition Facility (NIF) in Livermore (Kalifornien) bei zwei Durchführungen eines Experimentes, in dem 192 Laser eingesetzt wurden, durch Kernfusion mehr Energie zu erzeugen, als das Target zuvor aus der Laserstrahlung absorbierte (Fuel gain exceeding unity in an inertially confined fusion implosion, in: Nature, 12. Februar 2014; Will Dunham: U.S. scientists achieve 'turning point' in fusion energy quest, Reuters, 12. Februar 2014, vergl. Trägheitsfusion#Lasergetriebene Versuchsanlagen).

Unter Wikipedia:Auskunft/Archiv/2011/Woche 11#Brückentechnik "erneuerbare Energien" bzw. kann man in absehbarer Zukunft mit der Kernfusion rechnen? hatte ich am 17. März 2011 zu Magnet-Kernfusionsreaktoren geschrieben:

>>Praktisch kann bisher nur ein verschwindend geringer Teil des eingesetzten Tritiums fusioniert werden. Tritium ist eine Form des Wasserstoffs und daher extrem flüchtig. In dem Bericht Fusionsorientierte Plasmen (wobei es sich wohlgemerkt um einen rein fiktionalen Entwurf handelt) der Deutschen Physikalische Gesellschaft ist die Rede von einem Kilogramm Tritium, daß bei einem Unfall in einem Reaktor austreten könnte. Um das zu verwendende Tritium herzustellen muß zudem ein eigener Kernspaltungsreaktor betrieben werden.
Die Materialien des Fusionsreaktors würden demnach nicht "sehr schnell" abklingen, sondern mit einer Halbwertszeit von 10031,1 Jahren, also länger als eine durchschnittliche menschliche Lebensspanne. Selbst dann wäre diese Industrie also nicht nachhaltig. Es geht auch nicht um die "Wahl" der Materialien, sondern bestimmte Materialien existieren zur Zeit nicht, die man benötigen würden.
Unter anderem besteht auch das Problem, daß sich Tritium während des laufenden Betriebes in den Materialien des Reaktors immer weiter anreichert, wodurch das Risiko der Freisetzung bei einem Unfall immer weiter steigt. Schließlich müßte der Reaktor gestoppt und von dem Tritium gereinigt werden, was ein großes technisches Problem darstellt, siehe dazu auf book.google das Kapitel "Tritium related Constraints on a BPX Operation Schedule", in Clark, Reiter: Nuclear fusion research. Understanding plasma-surface interactions, Springer 2005, S. 296 ff. <<

Wenn es einmal gelänge, die Trägheitsfusion zu automatisieren und als Kraftwerk zur laufenden Energiegewinnung einzusetzen, wie viel radioaktive Stoffe (Tritium etc.) würden dann freigesetzt, insbesondere im Vergleich zu einem Magnet-Fusionsreaktor? Rosenkohl (Diskussion) 20:45, 14. Feb. 2014 (CET)

Der Reaktor würde mit Sicherheit so konstruiert werden, das im normalbetrieb kein oder kaum Tritium freigesetzt würde. Ansonsten würden Bau und betrieb nicht genehmigt. Aber ich glaube nicht, das die Frage für die Auskunft geeignet ist, da ein Vergleich zweier Technologien, die bisher nur als Experiment funktionieren, im hypothetischen späteren Betrieb kaum möglich ist.--79.238.45.243 21:21, 14. Feb. 2014 (CET)
Sowas kann man nicht vorhersagen. Kraftwerke sind Einzelstücke, selbst wenn sie als eine Reihe gleicher Reaktoren an einem Ort gebaut werden kann es sein das einer eine "Dreckschleuder" wird wärend alle sonstigen vorbildlich sauber sind. Die Fusionsforschung ist zudem noch immer weit entfernt von einer noch zu erfindenden praktikablen Methode. --Kharon 22:04, 14. Feb. 2014 (CET)

Ich hatte doch gerade ausführlich erläutert, daß bei den geplanten Magnet-Fusionsreaktoren von vornherein beabsichtigt wird, daß mit Sicherheit laufend Tritium freigesetzt wird. Auch beim Betrieb von Kohlekraftwerken und durch den Abbau von Kohle werden laufend große Mengen radioaktiver Stoffe wie Uran-238, Polonium-210, Radium-228 und andere Isotope genehmigt freigesetzt. Wäre ein Magnet-Fusionsreaktor mit riesigem Forschungsaufwand erst einmal entwickelt, so ist kaum anzunehmen, daß er keine politische Betriebsgenehmigung erhielte.

Bei jeder neuen Technologie werden selbstverständlich die Folgen und Nebenwirkungen abgeschätzt. Ein Forschungsprojekt erhielte keine öffentlichen Fördermittel, wenn der Antrag keine Abschätzung der möglichen Umweltfolgen enthielte. Meine Frage an die Auskunft der Wikipedia betrifft nicht, vorherzusagen, was für Umweltfolgen ein mögliches bestimmtes einzelnes Kraftwerk verursache, sondern welche Abschätzungen der Umweltfolgen durch Freisetzung von Tritium in einer dauerhaften Nutzung der Trägheitsfusions zur Stromerzeugung es gibt, insbesondere im Vergleich zu einem Magnet-Fusionsreaktor. Immerhin wird mir seitens Wikipedia im Artikel Kernfusionsreaktor#Alternative Konzepte suggeriert, Trägheitsfusion sei ein "alternatives Konzept" zur Stromgewinnung, Rosenkohl (Diskussion) 11:42, 15. Feb. 2014 (CET)

Währungsverbot

London droht den Schotten das Pfund wegzunehmen, wenn sie sich für die Unabhängigkeit entscheiden sollten ([35]). Wie soll soetwas gehen? Wer könnte einem unabhängigen Staat Schottland verbieten, das Britische Pfund zur gesetzlichen Währung zu erklären, außer mit Panzern? Die Frage betrifft auch den Euro: Was kann die EU unternehmen, wenn Syrien / die jugoslawischen Staaten / Nordkorea plötzlich Euros verwenden würden, weil sie das so toll finden? --178.195.134.244 15:13, 12. Feb. 2014 (CET)

Keine direkte Antwort, aber in dem Kontext zur Info: Eurozone#Ohne formelle Abkommen: Es gibt durchaus Länder, die einfach so den Euro benutzen, obwohl die EZB das gar nicht unbedingt will. —[ˈjøːˌmaˑ] 15:30, 12. Feb. 2014 (CET)
(BK) Man kann verhindern, dass Schottland offiziell z.B. Pfund bekommt oder selber herstellt. Dann kann man nurmehr an Pfund komen, indem man irgendwas in großen Mengen an Briten verkauft, ob das langfristig sinnvoll ist, ist eine andere Frage. Wenn man die Menge an Bargeld nicht erhöht, hat man aber bald ein Problem, weil die gesamte Geldmenge normalerweise ständig steigt und das bargeld, wenn man nichts nachdruckt, langsam weniger wird (ein gewisser Teil geht immer verloren bzw. wird zerstört). Irgendwann gibt es nicht mehr genug Bargeld, dass die Bankkunden problemlos Bargeld abheben können und kleinere gewerbe bekommen Probleme, weil sie entweder mit weniegr Kunden rechnen müssen oderauch bargeldlose zahlungen akzeptieren müssen, was für sie aber recht hohe Kosten verursacht. Dadurch, dass man nicht mehr problemlos bar zahlen kann, ist auch damit zur rechnen, dass weniger Geld im Umlauf ist, was das Wirtschaftswachstum bremst und zu Deflation führen kann. Länder, die bisher nicht z.B. den € haben, tun sich wenn sie ausreichend groß sind überhaupt schwer, genug € zu bekommen, um den € als Zahlungsmittel einzuführen wenn ihnen die EZB nicht dabei hilft. Also kurz gesagt: eine Wöährung gegen den Willen des ausgabestaates zu verwenden ist zwar möglich, aber wirtschaftspolitisch wohl kaum sinnvoll. Da ist es wohl sinnvoller, eine eigene Währung mit Wechselkursbindung and den Pfund oder € zu verwenden. --MrBurns (Diskussion) 15:35, 12. Feb. 2014 (CET)
Nachtrag wegen JøMa's Beitrag: Dein link bestätigt meine Vermutung: diese Staaten sind am BIP gemessen alle sehr klein. --MrBurns (Diskussion) 15:40, 12. Feb. 2014 (CET)
Diese Antwort verwirrt mich. Erstens gibt es auch (und vor allem!) Buchgeld, zweitens kann man irgendwo auf der Welt Pfund-Bargeld kaufen und physisch nach Schottland transportieren. --178.195.134.244 15:41, 12. Feb. 2014 (CET)
Ad 1.: Ja, gibt es, aber ich glaube nicht, dass in Europa das Wirtschaftssystem schon so weit ist, dass es mit einem Bargeldmangel problemlos zurecht kommt. Vieles kann man eben noch immer nur bar zahlen.
Ad 2.: Ja, kann man sicher, nur ob man damit geniug zu einem vernünftigen Wechselkurs zusammenkriegt, ist eine andere Frage. Außerdem erzeugt man damit künstlich eine höhere Nachfrage nach dem Pfund Sterling, was zu eienr allzu harten Währung führen kann, was wirtschaftspolitisch auch nicht sinnvoll ist. --MrBurns (Diskussion) 15:44, 12. Feb. 2014 (CET)
Kann den Schotten doch wurst sein, wenn die Briten Exportprobleme bekommen. --178.195.134.244 15:51, 12. Feb. 2014 (CET)
Was für ein Wechselkurs? Wenn es ginge, gäbe es ja nichts zu wechseln... --Eike (Diskussion) 15:52, 12. Feb. 2014 (CET)
Vorläufig nicht, aber sie müssten kontinuierlich Pfund nachkaufen. Schließlich dürften sie die Pfund ja nicht selber drucken, wenn ihnen das die Bank of England verbietet. --MrBurns (Diskussion) 15:55, 12. Feb. 2014 (CET)
Mann kann sich auch Pfund-Buchgeld bar auszahlen lassen, darauf wollte ich weiter oben schon hinaus. --178.195.134.244 16:00, 12. Feb. 2014 (CET)
Ja, aber nur so lange die Bank noch Pfund-Bargeld hat. Sonst kann mans nur abbuchen oder eventuell in einer anderen Währung bar auszahlen lassen. --MrBurns (Diskussion) 16:03, 12. Feb. 2014 (CET)
Ich meinte nicht der Schotte auf der schottischen Bank, sondern die schottische Bank holt Bargeld im Ausland. --178.195.134.244 16:07, 12. Feb. 2014 (CET)
Wenn die Bank of England Schottischen Banken keinen Kredit gibt, dann kollabiert der schottische Bankenmarkt schnell. Dafür muss kein Schuss abgefeuert werden. Yotwen (Diskussion) 15:37, 12. Feb. 2014 (CET)
Wahrscheinich hätten sie dann eine eigene Zentralbank. --178.195.134.244 15:44, 12. Feb. 2014 (CET)
Siehe den in der Frage verlinkten Artikel... --Eike (Diskussion) 15:51, 12. Feb. 2014 (CET)
Dort (Spiegel) steht aber nichts dazu. --178.195.134.244 15:54, 12. Feb. 2014 (CET)
Der schottische Plan ist: Schottland soll das Pfund behalten, die Bank of England bleibt die Notenbank und damit die letzte Sicherung gegen einen Staatsbankrott. --Eike (Diskussion) 16:01, 12. Feb. 2014 (CET)
Mit Zentralbank meinte ich nicht Notenbank, sondern das zentrale Bankenclearing. --178.195.134.244 16:07, 12. Feb. 2014 (CET)
Zahlreiche kleinere Länder haben keine Währung, sondern nutzen Euro, Dollar (Dollarisierung) oder die eines Nachbarstaates. Allerdings dürfen diese die Währung freilich nicht ausgeben (bzw. müssten dann wiederum ein Abkommen mit dem größeren Staat schließen, das das UK denen verweigern würde). Prinzipiell können sie freilich Pfundreserven auf dem freien Markt zukaufen, ob das aber in diesem Umfang möglich sein wird halte ich für eher zweifelhaft. (Nebenfrage: Wie schaffen es eigentlich solche Länder wie Bosnien oder Montenegro an dermaßen viel Devisen zu kommen, um Euro oder DM einführen zu können?)--Antemister (Diskussion) 15:55, 12. Feb. 2014 (CET)
Wobei beim Dollar ja die FED dafür sorgt, dass die Währung nicht zu hart wird, indem die Geldmenge ausreichend erhöht wird. Ob die Briten das auch machen würden, wenn Schottland ihre Währung unerlaubt mitbenutzt, müsste wohl vorher geklärt werden.Zur nebenfrage: Bosnien hat ein BIP von unter 20 Mrd. US$ und braucht auch enstprechend wenig Bargeld, die anderen Länder haben wohl noch ein niedrigeres BIP (zum Verglecih: Die Eurozone hat wohl über 10 Billionen $). Die Schotten hätten wohl ein deutlich höheres BIP. --MrBurns (Diskussion) 16:01, 12. Feb. 2014 (CET)
Ich glaube nicht dass sie dazu Devisen brauchen, solange sie die eigene Wirtschaftsleistung im In- und Ausland nur gegen Euro verkaufen. --178.195.134.244 16:04, 12. Feb. 2014 (CET)
@MrBurns, Bosnien druckt eigene Mark-Scheine und prägt eigene Mark- und Pfennig-Münzen. Deutsches Geld haben die Bosnier nur ganz am Anfang im Umlauf gehabt, als der Dinar unbrauchbar geworden war. --Rôtkæppchen68 16:07, 12. Feb. 2014 (CET)
Siehe Konvertible Mark. Ich würde das aber eher als eine Wärhung mit einer Wechselkursbindung von 1,95583:1 zum Euro sehen (früher 1:1 zur D-Mark). --MrBurns (Diskussion) 16:18, 12. Feb. 2014 (CET)
Auch Bulgarien mit seinen 7,4 Millionen Einwohnern hat mit dem Lew eine fest an den Euro gebundene Währung. --Komischn (Diskussion) 16:37, 12. Feb. 2014 (CET)
Auf File:Verwendung des Euro und daran gekoppelter Währungen weltweit.svg siehst Du alle Länder, die am Euro hängen. --Rôtkæppchen68 16:45, 12. Feb. 2014 (CET)

Es scheint sich also um eine leere Drohung gehandelt zu haben. --178.195.134.244 16:40, 12. Feb. 2014 (CET)

Die Ausgangsfrage sprach ja speziell von den Schotten. Und falls die sich tatsächlich unabhängig machen würden (unwahrscheinlich), dann würden sie wohl schnellstmöglich eine EU-Mitgliedschaft anstreben. Und die EU verlangt von allen Neumitgliedern eine zügige Einführung des Euro. --° (Diskussion) 16:47, 12. Feb. 2014 (CET)

Meine persönliche Meinung ist, dass das genauso laufen wird wie in Irland: Irland hatte nach dem Pfund Sterling das Irische Pfund im fixen Kurs 1:1, sogar die Münzen waren austauschbar. Das führte dazu, dass in Irland auch britisches Geld umlief und allgemein akzeptiert wurde. --Rôtkæppchen68 16:55, 12. Feb. 2014 (CET)
Ja, im Prinzip verlangt die EU die Euroeinführung bei neuen Mitgliedern, aber ich denke mal, dass das eher eine Papierforderung ist als eine, die wirklich durchgesetzt wird. Außerdem kann die EU machen, wenn man sich nicht an diese Verpflichtung hält? Ich denke, da werden maximal Geldstrafen verlangt, die sind zwar hoch, aber wohl nicht so hoch, dass sie wirtschaftspoltisch wirklich relevant sind. --MrBurns (Diskussion) 17:19, 12. Feb. 2014 (CET)

@MrBurns: Ecuador hat z. B. einen Geldumlauf von 8 Mrd. USD, bei jährlichen Im- und Exporten von ca. 25 Mrd. USD, bei einer z. Z. nahezu ausgeglichenen Leistungsbilanz (die früher sicher schlechter war. Im Vergleich zur ganzen Dollar-Geldmenge von ca. 2,5 Bio. USD ist das sicher lächerlich wenig, aber wie konnte Ecuador soviel Dollar zusammenkratzen (Schmuggel, Rücküberweisungen???)?--Antemister (Diskussion) 18:25, 12. Feb. 2014 (CET)

Das Pfund wegnehmen heißt umformuliert nichts weiter als die Selbstbestimmung über die Schuldenaufnahme zu verhindern. Das Pfund kann natürlich weiterhin verwendet werden. Schottland kann sich aber nicht mehr in Pfund verschulden, sondern wird in den Euro gedrängt, der in der britischen und schottischen Bevölkerung als weniger zuverlässig angesehen wird als das Pfund. Das ist alles.

Die Briten haben hier allerdings ein starkes Druckmittel, weil mit dem demnächst anstehenden Untergang des Dollar auch der Euro eine krasse Bodenwelle mitmachen wird, was zur Umgestaltung der europäischen Gesellschaft auch benötigt wird. Das Pfund hingegen könnte sich an diesem Ereignis wahrscheinlich nicht beteiligen. Die Schotten müssen also bei der Scheidung entweder die Nachteile einer nicht selbst bestimmbaren Verschuldung in der benutzten Währung oder den Anschluss an eine unberechenbare Gemeinschaftswährung. 2001:4C28:4000:721:185:26:182:29 18:22, 12. Feb. 2014 (CET)

So, so. Warst du zufällig der, der hier vor zwei Jahren vorhergesagt hat, dass nach einem Jahr der Euro untergegangen wäre? Ist immer praktisch, so als IP... --Eike (Diskussion) 19:03, 12. Feb. 2014 (CET)
Nein, der bin ich nicht. Wahrscheinlich gabs da mehrere, die sowas gemeint haben. Wovon ich aber überzeugt bin ist, dass der Dollar irgend wann in einem erdrutschartigen Ereignis verfällt. Wenn man sich das ganze Gebilde ansieht ist selbst für Laien (wie mich) rasch erkennbar, dass das niemals stabil bleiben kann. Und die Frage ist eben nur, welche Währung sich dann in welchem Maße beteiligt und was das für den jeweiligen Wirtschaftsraum bedeutet. Die Briten sind jedenfalls von der Standhaftigkeit ihrer Währung überzeugter als von der des Euro, das ist auch ein Fakt. Sie werden aber auch aus anderen Gründen der Scheidung nicht mehrheitlich zustimmen. 2001:4C28:4000:721:185:26:182:37 21:02, 12. Feb. 2014 (CET)
Aha. Und warum sollte sich ein unabhängiges Schottland "nicht mehr in Pfund verschulden" können? Wenn es trotz der vielen Bodenschätze Geld braucht, kann es das in der Währung aufnehmen, in der es Lust hat, und es in die Währung swapen, die es braucht. --178.195.134.244 22:22, 12. Feb. 2014 (CET)
Es geht um Geldschöpfung. Natürlich kann Schottland z.B. einen Schottischen Taler einführen, welchen ausgeben und dafür Pfund kaufen. Oder einen Kredit in Pfund aufnehmen. Aber es kann nicht mehr Pfund ausgeben und damit z.B. den Staatshaushalt finanzieren, indem es die Pfunde, die bereits in den Taschen der Leute sind, um den jeweils emitierten Betrag abwertet. Und das ist ja der Vorteil einer Währung, über die man verfügen kann. Die USA leben über diesen Mechanismus seit über 60 Jahren auf Schulden. Und die werden sie eines Tages innerhalb von wenigen Stunden auf einen Sitz zurückzahlen müssen. Das könnte beispielsweise an jenem Tag sein, an dem den Chinesen die Nerven durchgehen. und es könnte sein, dass sich der Euro an dieser Hyperinflation des Dollers beteiligt, weil Europa aus politischen Gründen den Dollar stützen muss. Die Schotten nun haben den Eindruck, dass das Pfund diesen Niedergang nicht mitmachen wird, dass es sich also nicht beteiligt. 46.115.130.204 19:37, 13. Feb. 2014 (CET)
Warum sollte Schottland denn überhaupt "Pfund kaufen", wenn es einen Schottischen Taler als eigene Währung hätte? Das wäre doch dann gar nicht mehr nötig. Es hätte dann eine eigenständige Währung wie die dänische oder tschechische Krone und könnte seine Kredite in der eigenen Währung aufnehmen. --Grip99 03:45, 14. Feb. 2014 (CET)
Mir kommen diese Gespräche hier surreal vor. Wie Selbstgespräche, die an einander vorbei reden. 2001:4C28:4000:721:185:26:182:35 21:39, 14. Feb. 2014 (CET)

Haben die Schotten überhaupt ein Interesse, das Pfund einzuführen? Wenn ja, können sie doch ein "Scottish Pound" als Währung einführen und kursmäßig an das £ binden. Alternativen: 1. Einführung des Euro, 2. Eigene Währung (mit beliebiger Bezeichnung) und 1:1-Parität zum Euro (auch Anbindung an US-$ wäre möglich), 3. eigene Währung mit völlig flexibler Kursgestaltung (auch das kann Vorteile haben). Diese britischen (besser: englischen) Drohungen sind eher psychologische Begleitfeuer, um ein Abstimmungsergebnis zu beeinflussen, könnte kontraproduktiv sein. --Dioskorides (Diskussion) 19:45, 12. Feb. 2014 (CET)

Was meinst du mit "Interesse, das Pfund einzuführen"? Wie kann man etwas einführen, was man schon längst hat? --Snevern 21:08, 12. Feb. 2014 (CET)
Hast Du den in der Ausgangsfrage verlinkten Artikel gelesen? Die SNP selbst plant, das Pfund zu behalten. --Grip99 03:45, 14. Feb. 2014 (CET)
"behalten" ≠ "einführen". Dioskorides stellt Überlegungen zur "Einführung" einer Währung an, die man schon deswegen nicht einführen kann, weil man sie derzeit bereits hat. --Snevern 10:10, 14. Feb. 2014 (CET)
Meine Antwort war nicht an Dich, sondern an Dioskorides gerichtet, erkennbar an der Einrückung, vgl. H:DS#Schritt_3:_Diskussionen_gliedern.
Aber im Übrigen ist es natürlich schon ein gewisser Unterschied, ob man ein "Scottish Pound" mit 1:1-Bindung zum britischen Pfund einführt oder ob man das britische Pfund direkt übernimmt. Denn die 1:1-Bindung ist, wenn man zwei verschiedene Währungen mit eigenen Notenbanken hat, zunächst einmal nur eine Absichtserklärung, die durch Maßnahmen auf dem Kapitalmarkt umgesetzt werden muss. Es gibt dann keine Garantie, dass die Bindung für die gesamte Existenzdauer der Währung beibehalten wird. --Grip99 01:35, 17. Feb. 2014 (CET)

Die Schotten haben keine gute Basis für eine Separation. Es geht im Wesentlichen um die Steuern durch die Ölförderung, die momentan nach London gehen. Das ganze wäre eine Geldquelle für ein paar Jahrzehnte. Das ist alles. Dafür würden sie ihre Sicherheit durchs Pfund aufgeben.2001:4C28:4000:721:185:26:182:35 21:43, 14. Feb. 2014 (CET)

Nach den aktuellen Umfragen ist eine relative Mehrheit der Schotten dagegen, aber noch keine absolute Mehrheit der Umfrageteilnehmer, vor allem weil ich glaub ca. 30% noch unentschlossen sind. --MrBurns (Diskussion) 00:51, 15. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:16, 19. Feb. 2014 (CET)

Deutsche Sprache, schwere Sprache!

Deutsche Sprache, schwere Sprache! In einige Wikipedia Artikeln steht: Ihr Grab befindet sich im Friedhof. Ist nun auf dem Friedhof oder im Friedhof die richtige Schreibweise? --77.211.154.185 07:23, 13. Feb. 2014 (CET)

In Bayern würde ich sagen eher „im“ [36], aber standardsprachlich wohl eher „auf“ [37]. -- HilberTraum (Diskussion) 08:23, 13. Feb. 2014 (CET)
+1 Geht beides und kommt wohl auf die Sichtweise an (verstehe ich es als (umfriedeten) Friedhof oder Gräberfeld (wie Fussballfeld/platz) oder will man auf die six feet under anspielen - die Einwohner kann man ja wohl nicht fragen... GEEZER… nil nisi bene 08:46, 13. Feb. 2014 (CET)
Hmmmm ... kühl, Unkraut zupfen, 15 cm ... hmmm ... GG
Die spannende Frage: Was ist den das Grab? Das unten (dann wäre "in" logischer; "Er lag in seinem kühlen Grab") oder das oben ("Grabpflege"=Unkrautzupfen hört sich mehr nach "auf" an)? Sogar HilberTraums bayrische Quelle [38] gibt für die Grabhöhe nur 15cm an, was wohl eher für "das oben" spricht?! Oder ist es irgend etwas, das oben heraus guckt? --Optimum (Diskussion) 09:59, 13. Feb. 2014 (CET)
Das Grab befindet sich am Friedhof --Jack User (Diskussion) 10:11, 13. Feb. 2014 (CET)
Ich glaub, diese unterirdische Betrachtung führt etwas in die Irre. Es gibt Wörter (Platz, Fußballplatz, Straße/Weg (jedenfalls die Verkehrsfläche), ...), die mit "auf" gebraucht werden. Diese werden vermutlich als Fläche angesehen, "auf" der sich etwas befindet. Das hat nicht unbedingt etwas mit Erhebungen (wie bei "auf dem Berg") zu tun. Andere Wörter (Wald, Tal, Fußballstation, Gasse, Zoo, ...) gebraucht man mit "im", in diesen Fällen sieht man wohl eher den Rand o.ä., innerhalb dessen sich etwas befindet. Es ist also eine Betrachtungsweise, die regional unterschiedlich sein und sich auch mit der Zeit ändern kann. .gs8 (Diskussion) 10:35, 13. Feb. 2014 (CET)
Gasse benutzt man so oder so: Das Haus liegt in der Gurkenhobelgasse. Mutter zum Kind: Geh auf die Gasse und spiele dort. --Rôtkæppchen68 10:42, 13. Feb. 2014 (CET)
Also auch eins von den Wörtern mit beiden Möglichkeiten. Ich hätte bei Gasse eher zu "in" tendiert, kann Dein Beispiel aber auch nachvollziehen. .gs8 (Diskussion) 10:51, 13. Feb. 2014 (CET)
Norddeutsch: das Grab befindet sich auf dem Friedhof; der Sarg wird in das Grab (Erdgrabstätte) versenkt. - Die Kinder spielen auf der Strasse, sie laufen runter auf die Strasse, sie treffen sich auf der Strasse, sie begegnen sich aber in der Bahnhofstrasse; die Schule befindet sich auch in der Bahnhofstrasse.
Englisch aber: Kids play in the street. Französisch: les enfants jouent dans la rue. - --86.212.49.19 06:09, 15. Feb. 2014 (CET)
In Norddeutschland spielen die Kinder immer noch auf der Straße. Strassen gibt es nur in der Schweiz und in rückständigen Gegenden Bayerns, die die letzten zwei oder drei Rechtschreibreformen noch nicht erreicht haben. --84.143.223.196 06:15, 15. Feb. 2014 (CET)
Ach ja, guten Morgen übrigens. Darf man eventuell in die Schweiz oder sonstwohin ausgewandert sein? Oder sollte man besser auf seiner Scholle festgenagelt bleiben? Darf man sich ggf. der Mühe und der Komplikation entziehen, auf einer azerty Tastatur das ß zu produzieren, bzw dasselbe jedesmal da unten aus der Fussleiste zu angeln? Darf man nicht? Noch nicht mal auf der Auskunftsseite? Na gut, wie hoch ist das Bussgeld? Vive la liberté! et la tolérance, mon cher --86.212.49.19 07:06, 15. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:16, 19. Feb. 2014 (CET)

Jetzt mal halblang, bitte! Und das an beide IPs! @86.212....: Ja, du darfst in die Schweiz (oder sonst wo hin) ausgewandert sein (solang's vor der Volksabstimmung war), und auch muss niemand auf einer AZERTY-Tastatur zwanghaft ein ß produzieren. Dafür gibt's kein Bußgeld. Aber @ 84.143...: Du hast bestimmt nur gedacht, dass einer wirklich denkt, Straße sei mit ss zu schreiben, und die 86er-IP hat sehr, sehr heftig darauf reagiert... --Eu-151 (Diskussion) 00:30, 19. Feb. 2014 (CET)

Ist Kleidersammeleimer in meinem Vorgarten zu stellen zulässig?

Bei uns stehen eigentlich ständig (immer von anderen "Firmen") diese runden ca. 40 cm hohen Eimer von Schuhsammlungen oder Kleidersammlungen rum. Sie werden einfach an der Straße auf das jeweilige Grundstück gestellt. Oder in den Vorgarten geworfen. Meine Frage: dürfen die das eigentlich? Ich glaube nicht, dass man eine konkludente Einwilligung annehmen kann, nur, wie soll man sich dagegen wehren? Ich darf ja auch nicht meinen Müll in fremder Leuts Vorgarten werfen. Früher hatte ich mich ja noch gefreut, dennen einen solchen Eimer kann man immer brauchen, aber neuerdings sind Löcher in die Böden gestanzt (die Verlustrate war wohl zu hoch...) --79.240.22.108 11:44, 13. Feb. 2014 (CET)

Hast du da eine konkludente Einwilligung angenommen, dass du dir ihre Eimer aneignen darfst? Na, wie dem auch sei... Mach einen Zettel, wirf die Eimer weg. Verklagen wirst du sie ja vermutlich nicht wollen. --Eike (Diskussion) 11:53, 13. Feb. 2014 (CET)
Aufstellen von solchen Container oder Sammeleimer bedarf einer kostenpflichtigen Sondernutzungserlaubnis, frage einfach mal beim Ordnungsamt deiner Stadt nach.--Search and Rescue (Diskussion) 11:56, 13. Feb. 2014 (CET)
da gab's mal n Beitrag bei Galileo (PRO7)... also der Staat sammelt die ein und muss sie auf ewig verwahren, falls der Eigentümer kommt, um seine Strafe und den Behälter zu bekommen... ob das auch für Privatpersonen gilt, weiß ich nich... [39] --Heimschützenzentrum (?) 11:58, 13. Feb. 2014 (CET)
(BK) Sondernutzung? Hmmm...
Wie ist denn die Haftungsfrage zu beurteilen? Ist der auf den Gehweg gestellte Eimer als "Müll" zu sehen, sprich, bin ich als Anwohner in der Pflicht für eine gefahrlose Nutzung des Gehweges im Hinblick auf den Eimer zu sorgen? Angenommen eine Omma fällt bei Dämmerlicht über den Eimer und bricht sich ein Bein... Hätte ich als Anlieger für "freie Bahn" sorgen müssen? Wenn wir in den Bereich Sondernutzung argumentieren, dann liegt die Verantwortung ja klar beim Eimeraufsteller. Wenn der aber keine Sondernutzungserlaubnis hat ist der Eimer dann "Straßenmüll" und muss vom Anlieger entfernt werden? Ein wirklich schwieriges Thema... Gruß Thogru Sprich zu mir! 12:02, 13. Feb. 2014 (CET)
Und dann die Fälle, wo Omma über die Telefonbücher stolpert, die einem alljährlich ungefragt vor die Tür gelegt werden... -- Ian Dury Hit me  13:24, 13. Feb. 2014 (CET)

Das sind alles viel zu komplizierte Überlegungen. Man kann den Eimerspuk beenden, indem man die Eimer einmal wöchentlich mit Wasser aus einem Schlauch befüllt. Die Kleidersammler werden rasch bemerken, dass es der falsche Platz für ihre Eimer ist. Alternativ dazu kann man die Eimer auch vollständig entfernen, wobei ich von einem höchstens 2-4 maligen Wiederaufstellen ausgehen würde ... je nach Intelligenzquotienten des zuständigen Aufstellers. (Die Eimer sind an weit entfernter Stelle - zum Beispiel im Stadtpark - abzustellen, um nicht den Tatbestand des Diebstahls einer fremden beweglichen Sache zu erfüllen, sondern lediglich "Entzug".) Gerade das wortlose Entfernen ist für die Nachbarn und den Aufsteller nervenschonend, da niemand von einer direkten Aggression ausgeht und letztendlich ja doch bemerkt wird, dass die Eimer unerwünscht sind.46.115.130.204 20:13, 13. Feb. 2014 (CET)

Da die Eimer (wie bereits genannt) Löcher im Boden haben entfällt Antwort eins (mit Wasser füllen). Auch Antwort zwei (Verstecken) ist hinfällig, weil es jedes mal andere sind. Antwort drei ist genauso dumm (weil es mir Arbeit aufhalst und ich beim Abstellen an einem anderen Ort genauso falsch handele und belangt werden kann). Ergo: Deine Antwort ist wertlos. Danke trotzdem! --87.180.117.175 12:26, 14. Feb. 2014 (CET)
Und du meinst, Verklagen wäre weniger aufwändig? Und dann auch noch immer wieder Verklagen, weil es jedes mal andere sind? Oder worauf zielt deine Frage, ob es zulässig ist, sonst? --Eike (Diskussion) 12:43, 14. Feb. 2014 (CET)
Wer sprach von Verklagen? Ich nicht. Aber die korrekte Antwort (habe ich vorhin erfahren) ist: Sich an das zuständige Ordnungsamt wenden. Wenn eine Genehmigung vorliegt, dürfen die Eimer verteilt werden. Aber nur auf öffentlichem GRund (nicht in meinem Garten). Wenn es keine Genehmigung gibt, wird der Verteiler, der auf dem Eimer angegeben ist mit einem Bußgeld belegt. Der Leiter des OA sagte, dass regelmäßig Bußgeldbescheide von 500 - 1000 Euro pro Verteileraktion rausgehen. Wenn der Eimer in meinem Garten landet, habe ich die Möglichkeit einer Strafanzeige wegen Sachstörung, die aber in aller Regel eingestellet wird. Die Meldung beim OA ist in aller Regel effektiver. --87.180.117.175 13:05, 14. Feb. 2014 (CET)
Genau das hab ich mit "Oder worauf zielt deine Frage, ob es zulässig ist, sonst?" zu erfragen versucht. --Eike (Diskussion) 13:09, 14. Feb. 2014 (CET)
Bußgelder muss nicht der Verteiler, sondern der Unternehmer zahlen. Die Verteiler sind irgendwelche angeworbenen Vollidioten, die eine Einweisung erhalten haben und die Eimer irgendwohin abstellen wo sie denken dass es was bringt. Genau so wie Spendeneintreiber für Tierschutzvereine nicht Unterstützer dieser Vereine sind sondern Harzer, die sich was dazu verdienen wollen. 2001:4C28:4000:721:185:26:182:35 22:10, 14. Feb. 2014 (CET)
VErteiler ist in diesem Fall sehr wohl der UNternehmer, der die EImer verteilen lässt. Wenn er sich dazu einen Erfüllungsgehilfen holt, so ist das seine Privatsache. Aber die Eigenschaft als "Verteiler" gibt er damit nicht ab. Ebenso wie der Spendeneintreiber das Tierheim etc ist. der Mann am anderen Ende der Büchse ist es auch nicht, denn der hat und braucht dazu keine Genehmigung. Aber der, für den das ganze gescheiht. --37.209.120.182 02:03, 16. Feb. 2014 (CET)

Reinkacken. Hilft bestimmt. 79.227.84.156 13:49, 19. Feb. 2014 (CET)

Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:17, 19. Feb. 2014 (CET)

PC-Internet Sucht bei Informatikern

Hallo, soweit ich weis gilt man ja als PC-Internet süchtig wenn man 2-3 h täglich an einem PC sitzt oder surft. Aber eigentlich ist das doch Käse ein Informatiker sitzt ja den ganzen Tag vor dem PC ab wann gilt hier dann eine Sucht, sind diese Berufsgruppen besonders gefährdet?--GroßerHund (Diskussion) 15:05, 13. Feb. 2014 (CET)

Das hieße, dass der durchschnittliche Junge internetsüchtig wäre. (Was ich nicht ausschließen will.) Das Berufsleben kann man da wohl schwerlich mitzählen; siehe auch Internetabhängigkeit. --Eike (Diskussion) 15:52, 13. Feb. 2014 (CET)
Seit wann wird eine Sucht am Konsum gemessen? Ich dachte, viel wichtiger ist die Fähigkeit, ohne das Suchtobjekt keine Entzugserscheinungen zu haben?--Alexmagnus Fragen? 16:31, 13. Feb. 2014 (CET)
Und ich dachte, sobald die Impulskontrolle aussetzt. -- Janka (Diskussion) 18:51, 13. Feb. 2014 (CET)
1. es geht da wohl um die Furcht, das Kind könne psychisch krank werden, wenn es nicht genügend RL-Kontakte pflegt (besonders die komplizierten: Sport, Tanzstunde, ...)... 2. ist aber erweislich Blödsinn, weil Menschen eher nicht dafür bekannt sind, psychische Probleme lösen zu können... das kann sogar ganz furchtbar nach hinten losgehen... die Christen glauben, dass es eher wichtig ist, sich an „Gott“ zu wenden (ob nun in Gruppen oder allein scheint weniger wichtig zu sein)... --Heimschützenzentrum (?) 16:37, 13. Feb. 2014 (CET)
Wenn es "krankhaft, übermäßig und zwanghaft" ist: Sucht#Sucht_in_der_Umgangssprache. Außerdem muß man von Beruf, Berufung, Leidenschaft, Lebensaufgabe, gar, oder schlicht Arbeit unterscheiden. Und . . "den ganzen Tag vor dem PC sitzen" klingt mir eher nach Apathie, Lethargie oder tot. Gar. Will sagen, das sacht nich viel aus, am PC kann man Unterschiedlichstes und völlig Gegensätzliches machen. Also tatsächlich: Käse. --217.84.69.72 18:19, 13. Feb. 2014 (CET)
Früher saß das Durchschnittskind wahsrcheinlich mehr als 2-3h vorm TV (ohne deshalb als süchtig zu gelten), wenn man jetzt so lange am Inetrnet sitzt statt am TV, wirkt sich das sicherlich nicht negativ auf die RL-Kontakte aus. Wenn man jeden Tag 2-3h vorm PC und 2-3h vorm TV sitzt vielleicht schon. Wobei das natürlcih von der konkreten Situation abhängt. Der Suchtbegriff wird heute jedenfalls infalionär verwendet und die Definition von Sucht an Konsumzeiten festzulegen ist jedenfalls zu stark vereinfacht. --MrBurns (Diskussion) 19:16, 13. Feb. 2014 (CET) PS: Übrigens können Computespiele durchaus mit Real-Life-kontakten einhergehen, vor allem wenn man die Konsolenspiele mitrechnet, was ja meist gemacht wird: bei vielen Konsolenspielen gibts noch einen Multiplayermodus, bei dem mehrere Personen an der selben Konsole spielen können. --MrBurns (Diskussion) 19:20, 13. Feb. 2014 (CET)
Damit ist es auf dem Punkt: Die Pädagogenkrankheit. In Werkzeugen einen Suchtfaktor zu erkennen? Wie krank muss man sein, um das nicht zu verstehen? Am besten Wegsperren, alles was nicht konform mit der persönlichen Weltanschauung ist. Aha Sanktion äh Behandlung von Sachen, die man nicht versteht?! Kennen wir das nicht von Radikalisten? Vielmehr sollte hier nüchtern erkannt werden, wenn sich Kinder in Spiele flüchten, eine Realitätsflucht antreten. Diese ist nicht zuletzt dem geschuldet, dass sie zu oft nur zu funktionieren haben, in der Schule ihr tatsächlicher Wissensdurst nicht gestillt wird und sie vielfach erfahren haben, dass sie im echten Leben (RL) ihre Ansichten und Wünsche defacto nicht gewünscht sind. Entsprechen unentschlossen sind diese bei der Berufswahl. Es wird ein Wissen eingetrichtert und andere Probleme erzeugt. Kinder erkennen darin, dass sie für das RL nicht richtig vorbereitet werden. Folglich protestieren sie und werden (hyper?)aktiv. Wenn sie Probleme lösen wollen, kommen Konflikte auf und dann werden sie mit in diesem Moment bezugslosen und folglich langweiligem Wissen abgespeist. Damit ist die Welt der Spiele das eine, der Computer ein Werkzeug, welches intelligenter ist, als der unidirektionale Informationsfluss des Fernsehens. Navigieren traut man den Kindern offensichtlich nicht zu. In anderen Länder schon. „Spielend lernen“ oder „durch spielen lernen“ ist nicht auf spielen zu beschränken, vielmehr als ein per „Try and Error“ Erfahrung zu sammeln. Die Zeit die das braucht alleine zu betrachten, ist dabei ein falscher Ansatz. Es ist vielmehr ein gezieltes Abtrainieren von zielorientierten Vorgehen und Durchhaltevermögen. Das beschädigt indem das Erfolgserlebnis an der vereitelten Lösung ausbleibt. Dies wurde bereits so beschrieben, dass auf diese Weise fleißige Buchhalter, aber kreativen Ingenieure produziert würden. Anders gesagt: Ohne Internet sollte wie Analphabetismus gewertet werden. --Hans Haase (有问题吗) 19:56, 13. Feb. 2014 (CET)
seit dem Internet gibt es weniger Tote aus purer Langeweile, will ich meinen. --80.108.60.158 06:26, 14. Feb. 2014 (CET)
Eine psychische Sucht besteht daraus, vor Problemen davonzulaufen. Welches Suchtverhalten der Mensch entwickelt, um seinen Problemen zu entgehen (Alkohol, Sexsucht, Internetsucht) ist zweitrangig und hängt eher von den persönlichen Vorlieben des Einzelnen ab. Ab dem Moment, wo du keine Kontrolle mehr über dein Verhalten hast und dieses Internet zwingend brauchst, bist du süchtig danach. Gehe bitte davon aus, dass kein Informatiker ein Problem damit hat, seinen Arbeitsplatz um 19:00 Uhr endlich zu verlassen und auch nur sehr ungern am nächsten Morgen um 8:00 Uhr bei der Arbeit erscheint. Die "Suchtgefahr" bei Informatikern ist sehr gering. -- 80.226.24.4 16:15, 14. Feb. 2014 (CET)
Als Informatiker um 19:00 gehen dürfen? Also fehlenden Optimismus kann man Dir nicht unterstellen. --93.211.14.5 17:17, 14. Feb. 2014 (CET)
Probier's mal mit Linux :-) -- 80.226.24.2 17:28, 14. Feb. 2014 (CET)
Genau darumn gehts ja: auch wenn jemand etwas nicht beruflich macht, kann man die Frage, ob er noch die Kontrolle über sein Verhalten hat nicht an der Zeit, die die Person damit verbringt, festmachen. Mit Kontrolle verlieren würde ich dem Fall verstehen, dass die Person eigentlich sehr viel wichtigere Dinge wegen dem Suchtverhalten nicht mehr macht, selbst wenn jemand z.B. 1x eine Nacht am PC durchmacht und 24h spielt, nachdem er Jahre lang auf den nächsten Teil seiner Lieblingsspielserie gewartet hat, ist das mMn noch immer kein Indiz für ein Suchtverhalten, außer er riskiert deshalb z.B. seinen Arbeitsplatz oder verabsäumt es, für eine wichtige Prüfung zu lernen oder fehlt bei der Beerdigung seiner Mutter. Wenn einer so lange spielt, dass er dadurch (wegen Schlaflosigkeit und reduzierter Nahrungsaufnahme) seine Gesundheit riskiert ist das natürlich auch ein Anzeichen für Sucht (daher dieser Südkoreaner war definitiv süchtig), aber die Frage, ob jemand Süchtig ist an einer durchschnittlichen Zeit pro Woche festzumachen ist jedenfalls zu einfach. --MrBurns (Diskussion) 02:10, 15. Feb. 2014 (CET)
ihr Freaks wisst aber schon, dass der Organismus Vitamin D, frische Luft, ausreichend Bewegung und einen ordentlichen Flüssigkeitsaustauch benötigt. --80.108.60.158 07:23, 15. Feb. 2014 (CET)
bei dieser Mixture kann man eventuelle auch klarer denken. Was ich aber noch los werden will: ich arbeitete in einigen Informatik-Projekten und da kam es vor, dass welche einfach am Abend vor dem Auto tot zusammenbrachen. Und kaum jemandem ging das nahe. Ich weiß, seltsam. Als Operator mit OPC-Kenntnissen versuchte ich den Fehlercode zu anaylsieren. Voila. --80.108.60.158 08:09, 15. Feb. 2014 (CET)
Für 2-3 Stunden muss man kein Informatiker sein, das haben heute auch schon die meisten Büro-/Bankangestellten, Sekretärinnen, usw. Das aber zur Sucht zu erklären ist aber in etwa so als würde man bei einer Putzfrau einen krankhaften Ordnungsdrang diagnostizieren, weil sie ja mehrere Stunden täglich mit putzen verbringt...--94.216.71.22 18:09, 15. Feb. 2014 (CET)
Vielleicht könnte man es so erklären: Wenn ein Informatiker auch am Wochende nur an seine Arbeit denkt, dann ist er vermutlich ein Workoholic. Wenn ein Informatiker auch am Strand von Grand Canaria ständig in sein Smartphone schaut, ohne den Strand genießen zu können, dann ist er internetsüchtig oder baggert gerade eine Frau an (oder falls weiblich einen Mann). Und wenn ein Kind täglich mehr als 2-3 h am PC verbringt, dann hat dieses Kind kaum eine Chance sich genügend im Knüpfen von sozialen Kontakten zu üben und könnte im späteren Leben somit leichter zu einem Workoholic oder Alkoholic werden. Das Leben als Informatiker schützt also nicht unbedingt vor dieser Krankheit, fördert diese aber auch nicht sonderlich. Ich kenne mindestens einen Informatiker, der selbst nach 3 Wochen kalten Entzug auf Grand Canaria immer noch keine SehnSUCHT nach seiner Arbeit entwickelte und auch das Smartphone ausschießlich zum Anbaggern von Frauen benützte :-) (Ich habe aber gehört, dass Wikipedia süchtig machen soll) -- Auskbeo (Diskussion) 14:03, 16. Feb. 2014 (CET)
Dem würde ich schon eher zustimmen, aber auch hier sollte man nicht verallgemeinern. Ich denke häufiger am Wochenende an die Arbeit, bin aber in meinen Augen weder süchtig noch ein Workoholic, sondern habe lediglich Spaß an dem was ich tue (Ja, es gibt auch Leute die nicht Montagmorgens schon die Stunden bis zum Wochenende zählen). Und wenn ich im Urlaub mit dem Smartphone am Strand liege, dann könnte ich genausogut googeln wo ich mittags am besten zum Essen gehe.--178.7.178.24 15:49, 16. Feb. 2014 (CET)
Na dann erzähl doch mal, nach was hast du denn so alles gegoogelt? Wetter, Sehenswürdigkeiten, Einkaufsmöglichkeit, Öffnungszeiten von Apotheke, Lokale, Disse, Flirtbekanntschaft, Anderes Hotel für nächsten Urlaub, Die lieben Daheimgebliebenen, Wassertemperatur, Übersetzung. Ich denke der Unterschied ist das Genießen vom Strand. Wenn man sich dem nicht mehr zuwenden kann, oder wenn man keine Kontakte mehr zu seinen Mitmenschen aufnimmt und sich abkapselt und hierfür das Smartphone einsetzt, dann wird es bedenklich. Vorher wohl weniger. -- Auskbeo (Diskussion) 16:14, 16. Feb. 2014 (CET)
Ich bin nicht so der Fan von Stränden und Meer, ich fahre stattdessen lieber zum Wandern in die Berge (da hab ich das Smartphone mehr zum messen der zurückgelegten Entfernen oder zum Fotografieren). Das von mir genannte war lediglich ein Beispiel, wenn jemand natürlich nichts anderes zu tun als im Internet zu surfen ist das natürlich was anderes. Ich finde es nur falsch sowas immer zu verallgemeinern: Nicht jeder der mehrere Stunden am Tag vorm PC sitzt ist gleich süchtig, genauso wie nicht jeder der am Wochenende mal an die Arbeit denkt gleich ein Workaholic ist. Wenn man natürlich an nichts anderes mehr denken kann und keine Zeit für Familie und Freunde mehr hat ist das schon bedenklich.--178.7.178.24 18:20, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:17, 19. Feb. 2014 (CET)

Gesetzliche Gewährleistung

Ist es im Rahmen der gesetzlichen Gewährleistung bei z.B. einem Austausch einer Festplatte wegen defekter Sektoren, es zulässig, dass man im Austausch eine gebrauchte Festplatte erhält? --95.112.162.12 13:09, 14. Feb. 2014 (CET)

Wenn eine nicht-gebrauchte Platte gekauft wurde, hat der Verkäufer AFAIK die Wahl, die gekaufte Platte zu reparieren (wird wohl bei defekten Sektoren keiner probieren), eine andere nicht-gebrauchte zu liefern oder das Geld zurückzuzahlen. Ohne Gewähr. --Eike (Diskussion) 13:21, 14. Feb. 2014 (CET)
MMn hat der Verkäufer wie Eike sagt die Wahl. Du musst dabei das erhalten, was du auch gekauft hast: War die gekaufte Festplatte neu, dann eine neue, war sie nur neuwertig, dann eine neuwertige, war sie gebraucht, dann eine gebrauchte. Fraglich ist nur noch, wie diejenige Abnutzung zu beurteilien ist, die du an der gekauften Festplatte verursacht hast: Wenn du sie z.B. 5 Monate lang ununterbrochen genutzt hast bevor sie defekt wurde, dann war sie ja beim Zeitpunkt des Defekts nicht mehr neu (auch wenn sie neu gekauft worden war). Ob du dann wieder eine neue Platte verlangen kannst, obwohl die, die du hast, zum Zeitpunkt des Defekts gar nicht mehr neu war, weiß ich nicht. So spontan bejahen würde ich das aber nicht. --88.130.111.148 13:38, 14. Feb. 2014 (CET)
Die Frage ist schon mal, was denn in den allgemeinen Geschäftsbedingungen steht. Diese können (zumindest leicht) vom Gesetzestext abweichen. Die Frage wäre also in diesem Fall, ob es prinzipiell verboten wäre, selbst in die AGBs zu schreiben, dass gegen Gebrauchtteile getauscht wird (und dies halte ich für durchaus wahrscheinlich, da dies aus meine Sicht eine unzulässige Benachteiligung des Kunden darstellt). -- 80.226.24.4 16:24, 14. Feb. 2014 (CET)
Natürlich ist es prinzipiell nicht verboten, gegen ein Gebrauchtteil zu tauschen: Ich bin ja nicht verpflichtet, gegen ein Neuteil zu tauschen, wenn ich nur ein Gebrauchtteil verkauft und bezahlt bekommen habe. Spannend ist die Frage für mittlerweile benutzte Neuteile und da wüsste ich nicht, wieso der Käufer, wenn er bereits Nutzen aus der Sache ziehen konnte, nur weil sie jetzt kaputt gegangen ist, nachher eine höherwertige Sache bekommen soll, als er vorher hatte. Das ist nicht Sinn des Gewährleistungsrechts. --88.130.111.148 17:07, 14. Feb. 2014 (CET)
Natürlich ist das nicht der Sinn des Gewährleistungsrechts. Es ist aber durchaus eine Folge des Gewährleistungsrechts. Der Verkäufer trägt das Risiko, die neu, aber mangelhaft verkaufte Sache später gegen eine neuwertige umtauschen zu müssen, ohne einen Ersatz für die zwischenzeitlich vom Käufer gezogenen Nutzungen zu erhalten. Das war vom Gesetzgeber anders gedacht und geregelt (es sollte durchaus einen Wertersatz für den Nutzungsvorteil geben), ist aber inzwischen durch die Rechtsprechung gekippt worden.
Beim Verkauf einer gebrauchten Sache ist eine Neulieferung häufig nicht möglich oder unverhältnismäßig, dann bleibt nur die Reparatur, oder, wenn diese scheitert, der Rücktritt vom Vertrag. Der Verkäufer einer gebrauchten Sache muss natürlich nicht als Nacherfüllung eine neue liefern. --Snevern 19:06, 14. Feb. 2014 (CET)
Ja natürlich. Das nennt sich juristisch "Nachbesserung". Nur wenn der Fehler mehrmals erneut auftritt kannst du ganz vom Geschäft zurücktreten und dein Geld zurück verlangen oder auf einen nagelneuen Ersatz bestehen. Ist z.B. manchmal bei sogenannten "Montags"-Autos gängige Praxis bzw. ein üblicher Streitfall. --Kharon 22:17, 14. Feb. 2014 (CET)
Nein. Nochmal langsam zum Mitlesen:
Nachbesserung (= Reparatur) und Nachlieferung (= Austausch gegen eine mangelfreie Sache) bilden zusammen die Nacherfüllung. Zwischen den beiden hat grundsätzlich der Käufer das Wahlrecht (jedenfalls im Regelfalle, also beim Kauf neuwertiger Gebrauchsgüter). Erst bei Unmöglichkeit oder Fehlschlagen der Nacherfüllung kommen die sonstigen Gewährleistungsrechte zum Zug, insbesondere der Rücktritt (Geld und Ware werden vollständig zurückgegeben) oder die Minderung des Kaufpreises (Ware bleibt beim Käufer, ein Teil des Kaufpreises wird erstattet). --Snevern 22:44, 14. Feb. 2014 (CET)
Das hat nur alles nichts mit der Frage zu tun. Die Frage war, ob ein Händler ein Neuteil gegen ein Gebrauchteil tauschen kann. Ob das nun im Wege einer PC-Reparatur erfolgt, oder weil eine einzelne Platte gekauft worden ist, ist sowieso egal. In beiden Fällen KANN der Händler doch gar nicht die Platte selber reparieren.(Schon mal versucht im eigenen Reinstraum? Dauert lang! Wird seeehr teuer!). Kommt also nur noch (neuwertige oder gebrauchte) Nachlieferung in Frage. Fraglich ist also, ob ein Händler irgendeine Festplatte aus dem Müll ziehen kann und einbauen darf. Oder einmal kurz die Frage umformuliert: Wenn ich einen neuen PC kaufe und der Händler diesen vor Übergabe 30 Meter in die Tiefe fallen lässt, darf er dann gegen ein Gebrauchtteil tauschen? Wohl eher nicht. Andere Frage: Wenn mir der Händler eine Festplatte mit 1000 h Laufzeit andreht und ich aber nur 10 h das Ding in Betrieb hatte, ist das dann ein gerechter Tausch? Und jetzt stellt sich die Frage, wie denn der Händler nachweisen kann, wie lange (das ist VIELLEICHT gerade noch möglich) die Platte gelaufen ist. Und wie oft hat sie den Boden geküsst und war diese waagrecht oder senkrecht eingebaut (so sollte diese auch weiter betrieben werden). Das Ding kann man drehen und wenden, wie man will, das führt zu ganz erheblichen Nachteilen beim Kunden. Ergo: Kann so niemals vom Gesetzgeber aus gedacht sein. -- Auskbeo (Diskussion) 00:10, 15. Feb. 2014 (CET)
Manchmal versagt WP:AGF ganz einfach... --Snevern 00:17, 15. Feb. 2014 (CET)
Genau den Fall des Fragestellers hatte ich auch. Bei mir war das zwar ein Headcrash, aber vom Prinzip war das genau das Gleiche. Ich wollte mein Geld, der Händler verwies mich auf die AGBs und er wolle reparieren. Darauf fragte ich höhnisch nach dem Reinstraum. Er erwiderte, dass er dann aber zumindest die Platte einschicken werde, um nachprüfen, ob ich das Ding heruntergeschmissen habe , abgesehen davon hatte ich diese ja einige Zeit genutzt usw. usw. Die Frage, die du hier beantwortet hast. stellt sich so überhaupt nicht in der Praxis. Wo soll denn der Verkäufer eine gebrauchte Platte mit ähnlicher Laufzeit herbekommen? Soll das ein Witz sein? Das ist doch alles graue Theorie und so gar nicht möglich. Wenn überhaupt wird er eine neue Platte einbauen und für alt-gegen-neu einen Abschlag verlangen (das fkt aber auch nicht in diesem Fall) -- Auskbeo (Diskussion) 01:06, 15. Feb. 2014 (CET)
@95.112.162.12: Ich verstehe dich so, dass du keine gebrauchte Platte haben möchtest, sondern eine neue und auf die Gewährleistung hoffst. Aber in dem Moment wo du dich darauf berufst, wird der Händler aus verhandlungstaktischen Gründen mit dir einen Exkurs in die Beweispflicht im Gewährleistungsrecht machen d.h. er wird sagen, dass er ja aber gar nicht wisse, ob du nicht für den Schaden verantwortlich bist, so ein Fehler ist ja noch nie aufgetreten bla bla bla. Dann wird er dir sagen, dass du doch froh sein sollst, dass er dir zumindest eine gebrauchte einbaut und bei einer neuen Platte müsse er erst einmal prüfen, ob nicht du daran schuld wärst bla bla bla. Mein Tipp: Schaue gar nicht nach, sondern gehe erst einmal fest davon aus, dass du Recht hast, dass er dir eine neue Platte einbauen muss usw. Weise ihn darauf hin, dass die AGBs nicht so sehr zu deinen Ungunsten als Käufer ausgelegt werden dürfen, weise darauf hin, dass du dich aber extra erkundigt hättest und versuche das ganze wortreich und mit Verhandlungsgeschick (der Verkäufer hat meist keine Zeit, also signalisiere, dass du viel Zeit hast) über die Bühne zu bringen (die wissen das nämlich auch nicht, wie das rechtlich genau geregelt ist). -- Auskbeo (Diskussion) 01:22, 15. Feb. 2014 (CET)
(BK)Nanana. Dir scheint vollkommen entfallen zu sein, dass Festplattenhersteller die zurückkommenden Platten reparieren und als “refurbished” den Händlern für Garantie- und Gewährleistungszwecke zur Verfügung stellen. Meine Gewährleistungsplatte hatte ein Etikett mit blauem Rand mit entsprechendem Hinweis drauf. Abgesehen davon ist es beim Händler Routine, reklamierte Platten erst einmal mit den Diagnoseprogrammen der Hersteller zu prüfen. Da stellt sich schon nach wenigen Sekunden heraus, ob die Platte alt und ausgeleiert ist oder doch aus Versehen runtergeschmissen wurde. Das hatte ich vor dem Gang zum Händler auch shcon getan und einen Ausdruck der Ergebnisse gleich mitgeliefert. Außerdem würde ich es nicht riskieren wollen, eine durch Unfall oder mutwillig zerstörte Platte dem Händler oder Hersteller als Gewährleistungs- oder Garantiefall unterzujubeln. Das kann teurer werden als eine gleichwertige Neuplatte – nämlich wenn der Hersteller oder Händler die Instandsetzung nach Aufwand in Rechnung stellt. --Rôtkæppchen68 01:26, 15. Feb. 2014 (CET)
Auskbeo, Du hast noch keinen Exkurs in die Tiefen des deutschen Gewährleistungsrechts gemacht. Bis zu einem halben Jahr nach Kauf ist der Händler beweispflichtig, dass der Schaden nicht von vorneherein bestanden hat und durch unsachgemäße Handhabung entstanden ist. Die restliche Zeit bis zum Ablauf der gesetzlichen Gewährleistung liegt die Beweispflicht beim Kunden, dass das Produkt von Anfang an fehlerhaft war und dass er das Produkt sachgemäß gehandhabt hat. --Rôtkæppchen68 01:29, 15. Feb. 2014 (CET)
Ne, hatte ich schon alles bedacht - wie gesagt - ich hatte den Fall ja selber. Woher weißt du, was das Diagnose-Programm sagen wird und ob die dort sauber arbeiten? Die 2 - 4 Wochen würde ich noch nicht mal abwarten wollen. Wenn der Fragesteller eine vernünftige Rechtsauskunft haben möchte, dann bräuchten wir hier die AGBs und das Kaufdatum. Ebenso den Verbleib der Platte und ob es sein könnte, dass er diese vielleicht selber beschädigt hat. Abgesehen davon wäre noch wichtig, dass er Endverbraucher ist. Das wird was längeres und lohnt aus meiner Sicht bei einer Festplatte nicht. (Ich bin vor Ladenschluß in das Geschäft und habe den Geschäftsleiter 10 Minuten lang genervt, bis ich die neue Platte hatte. Wir diskutieren hier bereits länger, als meine damalige Aktion dauerte). -- 02:20, 15. Feb. 2014 (CET) (ohne Benutzername signierter Beitrag von Auskbeo (Diskussion | Beiträge))
Nach Sekunden (was mMn nach weniger als einer Minute bedeutet) kann man wohl nur feststellen, dass die HDD heruntergefallen ist, wenn sie entweder äußerlich sichtbae Schäden hat (zerlegen dauert wohl doch länger als 1 Min.) oder das die S.M.A.R.T.-Werte noch auslesbar sind und das Herunterfallen (bzw. genauer geasgt: ene Beschleunigung außerhalb der Spezifikationen) an den S.M.A.R.T.-Werten erkennbar ist. Ist letzteres der Fall? Jedenfalls denke ich, dass die Herstelelr auch überprüfen, ob die HDD wirklich defekt ist, es werden sicher öfters HDDs für defekt gehalten, wenn in Wirklichkeit nur das Kabel oder Mainboard etwas hat. Das kann übrigens auch zu defekten Sektoren führen, die sich dann aber per Software entfernen lassen, wenn die Sektoren wirklich defekt sind, geht das nicht, außer die HDD ersetzt die defekten Sektoren durch Reservesektoren (davon merkt das OS bzw. Dateisystem nicht), das Ganze sieht man dann wieder per S.M.A.R.T. --MrBurns (Diskussion) 03:25, 15. Feb. 2014 (CET)
@MrBurns: Ich nehme an, dass die Hersteller den digitalen Weg komplett umgehen und sich direkt die analogen Signale vom Lesekopf ansehen und bereits dort erkennen, um was für einen Defekt es sich handelt (Fehlerkorrektur, Laufgeräusche, analoges Rauschen, Oberflächenanalyse usw). Weißt du etwas darüber?-- Auskbeo (Diskussion) 14:27, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:18, 19. Feb. 2014 (CET)

Warum urinieren Hunderüden im Handstand?

Bekanntlich heben unkastrierte männliche Hunde (Rüden) beim Urinieren ein Bein, um in ihrem "Revier" eine "Duftmarke" für andere Hunde resp. die Rivalen um die Weibchen zu hinterlassen. - Wird die Duftmarke recht hoch plaziert, beeindruckt das offenbar die anderen Hunde. - Daraus resultiert wohl auch die alte Volksweisheit: "Man soll nicht höher pinkeln, als man das Bein heben kann!" --- Mein Hund, ein unkastrierter Westiepoo-Designerrüde, macht beim Urinieren seit einiger Zeit einen Handstand auf den beiden Vorderpfoten - und überlistet dadurch weitaus größere Hunde, die einen wahren Riesen hinter der hochplazierten Duftmarke des Westiepoos vermuten. Ist Urinieren im Handstand - hier z.B. auch >auf youtube< bei einem anderen Hund zu sehen - eine angeborene Verhaltensweise bei Rüden (ich hab`s zuvor noch nie gesehen) - oder sind manche Hunde einfach nur schlauer als die Konkurrenz? --- (2.) Gibt es einen Terminus für das spektakuläre/zirkusreife "Handstandpinkeln" bei Hunden?

--Gordito1869 (Diskussion) 18:11, 14. Feb. 2014 (CET)

Vielleicht ist da nur beim Designen was schief gelaufen, normal ist das jedenfalls nicht. --91.0.145.105 20:46, 14. Feb. 2014 (CET)
...doch - scheint mit weit über >20000 "Gurgel-Treffern"< recht normal zu sein - und um es vorweg zu nehmen : Ich hab`s ihm nicht beigebracht - und ich pinkel auch nie höher, als ich mein mittleres Standbein heben kann :-) - MfG --Gordito1869 (Diskussion) 20:58, 14. Feb. 2014 (CET)
Wenn man die Bewegung eines möglichst weit nach oben gerissenen Beins immer weiter steigert, wird schließlich ein Handstand draus. Das ist nicht ganz ungewöhnlich, aber einen Fachbegriff gibt es meines Wissens dafür nicht. --Uwe G. ¿⇔? RM 21:59, 14. Feb. 2014 (CET)
Das gibt es nicht nur bei Hunden, auch bei Pandabären ist dieses Verhalten bekannt. Die Frage in der Überschrift beantwortet der Frager gleich selbst. Für Pandas ist es ebenso: Sie erscheinen den Revierrivalen größer. --Rôtkæppchen68 22:12, 14. Feb. 2014 (CET)
Hmh ? - Zum "Markieren" eines Baumes od. einer Mauer auf respektabler Höhe macht der Handstand ja Sinn; aber die Hunde (auch meiner) pinkeln >im Handstand auch auf den nackten Boden<; die Turnübung erscheint mir dann deutlich sinnlos. MfG --Gordito1869 (Diskussion) 22:30, 14. Feb. 2014 (CET)
+1 für den gesunden Menschenverstand.
Und massiver Einspruch zur Panda-Analogie (mein Kater meinte, dass ich mich garnicht erst zu "sowas" äussern sollte):
  • Bei Pandas (männlich) ist es gut untersucht und diese wuchtigen Tiere tun es alle. Evolution hat dafür gesorgt, das in den ausgedehnten Wäldern der Geruch eines Hochpinklers weiter getragen wird (mehr Damen informiert, bessere Chancen). Es hat nichts damit zu tun, "dass der Panda grösser erscheinen will."
  • Während ein "normaler" Rüde irgendwo gegen ein Hauswand oder einen Baum pinkelt, kann man bei kleinen Hunden im Handstand beobachten - hier mehrere Videos - dass sie dabei oft ziemlich sinnlos den Boden und nicht einen höheren Punkt treffen. Ihr Penis ist nach vorne gerichtet (wenn ich richtig informiert bin) also würde es viel funktioneller sein, wenn sie auf den Hinterbeinen laufend pinkeln würden (was sie können), wenn der Penis nach oben gerichtet ist (tun sie aber nicht). Und wenn es beim Panda geht, warum macht es kein Setter, der eine Dänische Dogge "beeindrucken" will? Nur kleine Hunde tun sowas, und kleine Hunde machen viele merkwürdige Dinge... GEEZER… nil nisi bene 23:10, 14. Feb. 2014 (CET)
Haben wir es hier also jetzt mit einem Designer-Panda-Hund zu tun? Es sollen davon ab ja auch schon Hochpinkler vorm Tiefspüler gesichtet worden sein. Aber es stimmt: kleine Hunde machen viele merkwürdige Dinge --91.0.145.105 00:12, 15. Feb. 2014 (CET)
@Grey Geezer: Ich teile die (imho) zutreffende Wahrnehmung, dass nur kleine Hunde im Handstand urinieren; bei großen Rassen - wie etwa der Deutschen Dogge oder dem Neufundländer - wäre das imho kaum vorstellbar (und ist offenbar auch nicht dokumentiert). - Dem natürlichen Bewegungsapparat folgend, gehen Hunde außerdem viel öfter und vorzugsweise auf die Hinterläufe - und der Handstand über die Vorderpfoten wirkt von daher auch schon optisch fast widernatürlich (mein Hund steht oft kerzengerade und senkrecht auf seinen Vorderpfoten - aber immer uriniert er dabei; er macht das aber stets nur dann, wenn er an dieser Stelle eine Rivalen erschnüffelt hat und sich über diesen - knurrend und scharrend - aufregt). Von daher ist imho die Frage berechtigt, ob das Urinieren im Handstand nur bei kleinen Hunden ein angeborener "Reflex" ist (Erbanlage) - während große Rassen/Hunde nicht über diese Erbinformationen verfügen (wobei ja auch z.B. ein Neufundländer mit der Deutschen Dogge oder dem Irischen Wolfshund durchaus größere Rivalen besitzt). - Oder aber aber die heutigen modernen Designerhunde entwickeln sich evolutionär langsam zu Primaten fort - währenddessen die (ohnehin bereits stark überzüchteten) großen FCI-Rassen sich nicht mehr weiterentwickeln können. - MfG --Gordito1869 (Diskussion) 08:32, 15. Feb. 2014 (CET)
Hier, was die Nacht noch brachte:
Pandas unterlagen (bis jetzt) der natürlichen Selektion. Wo und wann soll das bei kleinen Hunden passiert sein? Die wurden in 100-200 Jahren zusammengeschustert. Es ist sicherlich so wie bei den Silberfüchsen von Beljajew: Als er Pelzliferanten Richtung "handzahm" züchtete, kriegte er zwar handleckende Polarfuchshundis, aber sie hatten auch einen geringelten Schwanz und geflecktes Fell (unerwünschte, aber im nachhinein erklärbare Seiteneffekte im genetischen Hyperraum). Das gleiche ist wohl beim Rumzüchten von Kleinhunden passiert: Ein evolutionsbiologischer (nicht störender?) Seiteneffekt. Irgend etwas im Reiz- oder Muskelsystem dieser Tiere läuft schräg, so dass sie tun, was sie tun. Züchtet man sie auf Länge (Dackel), passiert das Handstandpinkeln nicht.
Das bekommt man also, wenn man als Mensch die Selektion in die Hand nimmt: Ein kleines Tier, das sinnfrei im Handstand Elbenschrift auf den Bürgersteig pinkelt.
Ich weise auch alle Eltern hier darauf hin, dass in unseren Breiten die natürliche Selektion auch nicht mehr funktioniert. Kommt ihr also eines morgens ins Kinderzimmer und Junior setzt zum Handstand an und sagt: "Kuck mal, was ich kann!!" - bitte nicht wundern! Streicheln und Leckerli geben... :-) GEEZER… nil nisi bene 09:32, 15. Feb. 2014 (CET)
Hmh, >hier ist offenbar die Lösung< ... und die ganz großen Rassen haben derlei Gehabe der kleineren "Kollegen" offenbar nicht nötig. (PS: ...beim sog. "Beamtenhund gelten natürlich >ganz andere Naturgesetze<) - MfG --Gordito1869 (Diskussion) 10:52, 15. Feb. 2014 (CET) --- PS: Ich halte meine Frage für hinlänglich beantwortet - und bedanke mich bei allen Beteiligten. - MfG aus Köln : --Gordito1869 (Diskussion) 09:52, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:19, 19. Feb. 2014 (CET)

Ägyptische Fayence

Haben alte ägyptische Fayencen (etwa diese kleinen Amulette, wie man sie etwa auf Ebay häufig findet) irgendwelche besonderen Ansprüche an Lagerung, Luftfeuchtigkeit, Raumklima, Licht, etc., oder ist das einfach quasi bisschen empfindlicheres altes Porzellan (also quasi "nix für die Spülmaschine", ansonsten aber eher anspruchslos)?

--87.167.239.172 18:28, 14. Feb. 2014 (CET)

spezifische Materialkunde plus bisherige Lagerung, und deren sichtbaren und nachvollziehbaren Schäden, sollten bei der Suche deiner Recherche weiterhelfen. --80.108.60.158 08:36, 15. Feb. 2014 (CET)
Leider nein, jedenfalls nicht im hiesigen Artikel zum Thema. Und eine derartige Begutachtung von solchen Stücken in natura oder auf Bildern führt auch nur zu Erkenntnissen wie "zerbrechlich, nicht in der Wüste rumliegen lassen und dann versehentlich drauftreten", ansonsten vermittelt sich nur der Eindruck, die Dinger seien relativ robust und anspruchslos - aber das mag ja täuschen. Der Artikel über Fayence schweigt sich hinsichtlich der materiellen Eigenschaften des Stoffes ebenso ziemlich aus, und antike ägyptische F. werden dort nicht einmal erwähnt, was ich schon sehr merkwürdig finde. Aber vielleicht weiß ja hier jemand mehr. --87.167.242.85 09:19, 15. Feb. 2014 (CET)
eventuell hilft der Begriff Majolika weiter. --80.108.60.158 09:32, 15. Feb. 2014 (CET)
in der Regel würde ich es mit einem "nebelfeuchtem Frottétuch reinigen. Farben verblassen im Sonnenlicht - glasierte Keramik hält dem länger stand (die dürften sich das damals auch schon überlegt haben.) ansonsten kann man es wie normale gebrannten Ton behandeln. --80.108.60.158 09:56, 15. Feb. 2014 (CET)
Ok, danke. Majolika war auch aufschlussreich. Verdreckt ist meines zum Glück nicht, ich wollte es nur dauerhaft an einem Ort präsentieren, wo gelegentlich auch mal höhere Luftfeuchtigkeit herrscht (nicht draußen/in der Sonne), und frug mich dann schnell, ob das denn wirklich so eine gute Idee ist, oder dem Stück klimatisch schaden könnte (auch wenn es nichts teures oder besonderes ist) und ob nicht sogar im Gegenteil besondere Vorkehrungen zur Lagerung nötig sind. --87.167.242.85 10:08, 15. Feb. 2014 (CET)
bei Luftfeuchtigkeits-Schwankungen muss man die Materialdichte beachten. Ein Extrembeispiel: ein kleiner Riss im Asphalt, und es füllt sich mit Regenwasser - kurz darauf gefriert es. Durch die verschiedenen Eigenschaften von flüssigem Wasser und gefrorenem Zustand springt der Asphalt auf und man hat ein Schlagloch. Das ist ein Extrembeispiel kann aber beim Verständnis zur Lagerung helfen. --80.108.60.158 10:15, 15. Feb. 2014 (CET)
Die Rissbildung bei schwankender Luftfeuchtigkeit hat mit Dichte nichts zu tun. Vielmehr hat es damit zu tun, dass sich viele Stoffe unter dem Einfluss der Luftfeuchtigkeit ausdehnen und beim Trocknen wieder zusammenziehen und dabei Risse (Trockenrisse (Holz), Trockenrisse (Holz), Schwindriss) bekommen. Lediglich bei Temperaturen unter 0 °C ist die Dichte für die Rissbildung ausschlaggebend. Keramik ist vor allem durch gefrierendes Wasser gefährdet. Dass alte Keramik – egal ob glasiert oder nicht – frostfrei gelagert werden muss, versteht sich eigentlich von selbst. --Rôtkæppchen68 15:25, 15. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 10:02, 18. Feb. 2014 (CET)

MAC und aspx (erl.)

Liebe AUssies,

in der Hoffnung, dass mir hier so gut wie bisher immer geholfen wird, wollte ich fragen, wie ich folgendes Problem lösen kann.

Folgende Website der staatlichen Archive Dänemarks bietet ihre Kirchenbücher nur als .aspx an. Diese kann ich auf meinem Mac nicht öffen, weder mit Firefox noch mit Safari. Wenn ich den Inhalt des Hilfsforums von den Archiven richtig verstanden habe, liegt es aber nicht am Browser, sondern daran, dass Macs ein benötigtes Java-Applet als gefährlich einschätzen. (Merkwürdig, dass Java-basiertes online Banking klappt...) Jemand ne Idee, was ich machen kann? Vielen Dank! Catfisheye (Diskussion) 18:42, 14. Feb. 2014 (CET)

Keine Ahnung, ob das hilft.  TRN 3.svg • hugarheimur RIP Klara Winter 19:04, 14. Feb. 2014 (CET)
Leider nicht. :( Catfisheye (Diskussion) 19:14, 14. Feb. 2014 (CET)
Ich kann die am PC (Win7, FF) auch nicht öffnen. Wenn ich die aspx-Datei runterlade und mit dem editor öffne (oder gleich mit IE öffne), kommt etwas das mir wie xml (oder java?) aussieht, aber geraten ohne Gewähr. Wie soll das Ganze überhaupt funktionieren, könnte das netterweise jemand erklären? Spontan sieht mir das für eine öffentliche Seite nach "serious bad programming" aus, was hieße das nicht nur deutsche Behörden solche Sachen verbocken. Oder brauch man da irgendeine Zusatzsoftware/Plugin, was ich nicht erkenne mangels Dänisch-Plugin? Solaris3 (Diskussion) 19:31, 14. Feb. 2014 (CET) Nachtrag: Vermutlich liegts daran, dass ich auf dem Rechner hier kein Java installiert hab... Solaris3 (Diskussion) 20:09, 14. Feb. 2014 (CET)
Auf meinem Arbeitslaptop (Win 7 und Chrome) ging es problemlos. Runterladen und klicken zum Öffnen. Die Archive haben offenbar ein eigenes Bildanzeigeprogramm, mit dem nicht nur ich Probleme habe. Sie sagen, ich soll Java installieren, was ich m. E. getan habe, da sonst das online Banking nicht ginge. Ausserdem haben sie das Programm nur mit WIn XP mit Servicepack 2, Win Vista und Win 7 getestet. TOLL... Catfisheye (Diskussion) 19:46, 14. Feb. 2014 (CET)
Es scheint sich um JNLP-Dateien zu handeln. Hilft vielleicht das? PS: Ich habe leider keinen Mac, deswegen stochere ich hier im Nebel ;o( Grüße  TRN 3.svg • hugarheimur RIP Klara Winter 19:53, 14. Feb. 2014 (CET)
(BK) Ohne wirklich zu wissen, was ich damit auslöse, habe ich beide Methoden ausprobiert und das Ergebnis war Null. Wenn ich das irgendwie verstehe, verhält es sich so, dass sich automatisch das Archiv-Bildanzeigeprogramm öffnen müsste, welche auf das Java Web Start App basiert, das aber seit Java 5.0 Teil der normalen Java-Software ist. Da sich das Programm aber nicht öffnet, fehlt meinem Rechner ein App mit der er die Dateien anzeigen kann. Puha. Catfisheye (Diskussion) 20:15, 14. Feb. 2014 (CET)

Achtung: Es gibt einen Unterschied zwischen Java (Applet) und Javascript. Dein Banking verwendet offenbar Javascript, die von Dir gewünschte Website ein Applet. --° (Diskussion) 20:05, 14. Feb. 2014 (CET)

Okay. Also ich bin auch mit Macs überhaupt nicht vertraut. Mein "finder" findet folgendes unter Java als Suchwort: JavaAppletPlugin.plugin Aber wie ich rausfinde, was ich installiert habe, raffe ich momentan noch nicht. Catfisheye (Diskussion) 20:15, 14. Feb. 2014 (CET)
Das ist nicht ASPX (das wäre Serverseitig), sondern ein Java-Applet, das im übrigen sogar gültig signiert ist. Iced Tea (Java-OSS auf Linux) startet es und man kann durch die Einzelseiten der Kirchbücher browsen und diese als Grafiken abspeichern. Welche brauchst du? -- Janka (Diskussion) 20:18, 14. Feb. 2014 (CET)
Okay, die Dateien unter Downloads werden mit .aspx angezeigt. Ich muss leider ziemlich viele Einträge nachschauen und hoffte von daher eine Lösung zu finden. :/ Mift. Catfisheye (Diskussion) 21:38, 14. Feb. 2014 (CET)
Hast du die neueste Java-Version? Zitat von [40] (wo es ebendiese gibt): "Oracle Java-Version 7u25 und darunter wurde von Apple auf OS X deaktiviert. Durch das Update auf die neueste Version wird sichergestellt, dass Java auf Mac OS X ausgeführt werden kann." -- Rosenzweig δ 22:39, 14. Feb. 2014 (CET)
Also die Java-Website sagt: Sie haben die empfohlene Java-Version installiert (Version 7 Update 51). Catfisheye (Diskussion) 23:20, 14. Feb. 2014 (CET)
Aber da ist doch auf dem Server was falsch, gell? ASPX sollte doch nicht ausgeliefert werden? --Eike (Diskussion) 22:41, 14. Feb. 2014 (CET)
Der Server liefert nicht .aspx aus, sondern der Server nennt die ausgelieferte JNLP- bzw XML-Datei nur .aspx. Mein Firefox speichert die Datei als ViewImage.aspx.jnlp im Cache. Möglicherweise stimmen die serverseitigen MIME-Type-Einstellungen nicht. --Rôtkæppchen68 23:11, 14. Feb. 2014 (CET)
Dann ist aber auch der MAC falsch in seiner Typenangabe, er sagt der Typ wäre "aspx File (1.9 KB)". Das ist ziemlich irreführend. Catfisheye (Diskussion) 23:20, 14. Feb. 2014 (CET)
Hm. Wie genau versuchst die Dateien zu öffnen? Direkt aus dem Browser raus (statt abspeichern)? Oder als gespeicherte Datei von der Festplatte? Falls letzteres: Kannst du die Datei, per Rechtsklick, mit einem ausgewählten Programm starten, womöglich per Texteingabe des Programmbefehls? Unter Linux geht das, der benötigte Befehle ist javaws (Java Web Start). Funktioniert so bei mir. Aber ich habe keine Ahnung, ob so was unter MacOS geht. -- Rosenzweig δ 23:54, 14. Feb. 2014 (CET)
Im Finder kann ich nur aus einer begrenzten Auswahl an Programmen die heruntergeladene Datei zu öffnen versuchen (wie z. B. Iphoto, Textedit, etc. was alles nicht funktioniert.) oder zum App Store gehen. Eine Möglichkeit zum Befehle geben kenne ich hierbei nicht. Catfisheye (Diskussion) 00:34, 15. Feb. 2014 (CET)
Sehr fein, der letzte Hinweis hat mich zum weiteren Experimentieren angeregt und in Kombination mit dem was Torana oben verlinkte, klappte es. Falls es irgendjemandem dient (Wenn man es weiss, wirkt es irre einfach.): Ich atte festgestellt, dass man von recommended applications auf all applications umstellen konnte, weshalb ich beim "open with" nochmal ins System > Library > CoreServices > Java Webstart ausgewählt. (Obwohl ich als "default" wählte, muss ich das jedes Mal von Hand machen, aber was soll's. :) ) Das wirkt. (Merkwürdig auch, dass das App nicht gefunden wurde, als ich nach "Java" via Finder gesucht habe.) So, jetzt froh in die Heia. Vielen lieben Dank Euch allen! Catfisheye (Diskussion) 01:03, 15. Feb. 2014 (CET)
falls du so etwas öfters per Hand machen musst, solltest du dir unbedingt den Automator zur Hilfe nehmen. --80.108.60.158 12:30, 15. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 10:02, 18. Feb. 2014 (CET)

Kortison Abbau

--Edelweiss57 (Diskussion) 09:14, 15. Feb. 2014 (CET) Ich habe nach 8 Monaten Kortison einnahme (Prednison 20 U. 30 mg täglich ) Wassereinlagerung. Was kann ich dagegen tun um das Wasser schnell wieder auszuscheiden? Ich fühle mich wie in einer Zwangsjacke,meine Bewegungen sind sehr eingeschränkt,leide unheimlich unter diesen Zustand . Danke

mit deinem behandelnden Arzt Rücksprache halten. --Search and Rescue (Diskussion) 09:21, 15. Feb. 2014 (CET)
Medizinische Auskünfte werden hier nicht gegeben, das wäre auch hochproblematisch, u.U. gefährlich und nicht zulässig -- - Majo Senf - Mitteilungen an mich 10:23, 15. Feb. 2014 (CET)
Gesundheitshinweis Dieser Artikel behandelt ein Gesundheitsthema. Er dient nicht der Selbstdiagnose und ersetzt keine Arztdiagnose. Bitte hierzu diesen Hinweis zu Gesundheitsthemen beachten!
Helfen kann salzreduzierte Diät, der Arzt kann ein Diuretikum verschreiben, evtl auch Herzmedikamente.--Giftzwerg 88 (Diskussion) 17:34, 15. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 10:03, 18. Feb. 2014 (CET)

Zum Monotheismus

Angeregt durch andere Fragen auf dieser Seite: Es heißt ja immer, der Monotheismus sei eine große Kulturleistung gewesen, die entsprechenden 3 Weltreligionen dadurch verwandt, etcpp. Nun habe ich dazu eigentlich zwei Fragen. In den Artikeln zum Islam oder zur Kaaba wird ziemlich deutlich, das dort zuvor ein polytheistisches Heiligtum bestand, und mutmaßlich Allah zuvor Teil einer ganzen Heerschaar von Göttern war oder ggf. auch Hubal unter neuem Namen. Wie verhält es sich aber mit dem Jahwe, den dann ja das Christentum auch modifiziert erbt? Ich las vereinzelt von ähnlichen Ursprüngen, also zunächst eine lokale Gottheit eines Stammes oder Ortes, die dann die "Vorherrschaft" errang? Laut Bibel offenbart sich dieser Gott doch zum ersten Mal Moses? Aber auch vorher spricht er ja schon zu diversen Personen, oder? Die zweite Frage bezieht sich auf den Zoroastrismus: Ist der nicht noch wesentlich älter und vollzog unter Zaratustra als erster die Wendung zum einen Gott, hier: Ahura Mazda? Warum wird das so wenig gewürdigt oder warum so wenig spätere Entwicklungen anderer Religionen zum Monotheismus in diesem Lichte betrachtet und die Kulturleistung anderen zugeschrieben? --87.167.242.85 09:44, 15. Feb. 2014 (CET)

--87.167.242.85 09:44, 15. Feb. 2014 (CET)

Ich würde bei dem eine Art von "gedankliche Evolution" miteinbeziehen.
Im besonderen möchte ich noch Zoroaster als "Macht des Lichts, Schöpfer und Erhalter der Welt" also ein Attribut einer anscheinend wahrgenommenen übergeordneten Begebenheit benennen. Diese übergeordnete Begebenheit finden wir bei den Vielgötterglauben wieder: einer war zuständig für den Sonnenaufgang, der andere blies den Wind etc... Sehr schön in den Mythen der griechischen Geschichte und weitergesponnen in der religiösen Ansicht ihres himmlischen Pantheons. Im Christentum/Islam und Judentum glaubt man eine Befreiung einer Knechtschaft aus Der Sklaverei in Ägypten, durch eben diesen Mose. Die Verbindung der drei biblischen Religionen findet sich im Urvater Abraham. In der Bibel steht: Er ist der Selbe, heute und in Ewigkeit. Im Christentum ist man der Meinung, dass Gott sich selbst in einer Person den Menschen offenbarte. Im Islam ist Jesus nur ein Prophet, und bei einigen Juden lediglich ein Trottel. --80.108.60.158 10:11, 15. Feb. 2014 (CET)

Diese gedankliche Evolution vollzieht sich also zuerst in Persien, möglicherweise auch noch mal episodenhaft und kurzlebig in Ägypten, und beeinflusst dann als Motiv die späteren monotheistischen Religionen - die aber jeweils eifersüchtig diese Kulturleistung für sich verbuchen oder wenigstens der ältesten Religion der drei zurechnen wollen. Aber warum liest man davon so wenig, und warum wird das nicht in der Schule unterrichtet, etwa aus Respekt gegenüber den jeweiligen Glaubensgemeinschaften oder wegen deren Macht? Mir wird das alles erst heute so richtig klar, und ich war auf dem Gymnasium. Ernüchternd empfand ich, wie oft sich Religionen weniger durch geistige Evolution als durch Krieg, Gewalt, Zwang und Furcht verbreitet haben, auch schon lange vor Islam und Christentum. Soeben las ich hier zb., die jüdische Vorstellung von Himmel und Hölle beruhten wohl auch auf älteren babylonischen Vorstellungen, die sie dann in der Zeit des babylonischen Exils übernahmen. Also geistige Evolution, aber zugleich auch Zufall, und Sieger, die nicht nur die Geschichtsbücher, sondern auch die religiösen Vorstellungen "neu schreiben" oder beeinflussen. Wäre es in Anbetracht all dieser Dinge nicht höchste Zeit für eine universelle Weltreligion, wenn man meint, so etwas zu benötigen? Und wie lebt man überhaupt als Gläubiger in einer Postmoderne, in der man eben alles glauben kann und viele alles mögliche andere glauben, oft ebenso überzeugt davon wie man selbst? Die Frage geht vielleicht über den Horizont dieser Seite hier zu weit hinaus. --87.167.242.85 10:26, 15. Feb. 2014 (CET)

ne. so schwierig und unseren Horizont übersteigend kann es gar nicht sein. Denn wenn dann gibt es entweder einen Gott oder eben keinen. Denn eine Religion kann sich eben nur auf einen Gott beziehen, und das nennt man dann "katholisch" die eine Wahrheit. --80.108.60.158 10:35, 15. Feb. 2014 (CET)
So einfach ist es ja gerade nicht. Denn selbst wenn es keinen dieser ganzen Götter "gibt" im Sinne eines unsichtbaren Wesens mit Bewusstsein und Willen, etcpp, wovon ich persönlich ausgehe, so entfalten sie ja trotzdem eine gewaltige Wirkmächtigkeit in Form all der Menschen, die an sie glauben und für sie streiten, oder auch sie einfach für eigene Zwecke (zb. Macht) benutzen. Insofern "gibt" und gab es sie natürlich allesamt, und man sollte sich hüten, sie einfach abzutun und zu ignorieren. Es gibt und gab auch keine Jediritter oder Hobbits, trotzdem werden Milliarden Umsatz mit ihnen gemacht und sie sind dadurch eine ernste Angelegenheit. Und ursprünglich religiös fundierte Vorstellungen ziehen sich unbewusst durch jede heutige Gedankenwelt, auch bei Atheisten, das lässt sich gar nicht vermeiden. --87.167.242.85 10:50, 15. Feb. 2014 (CET)
ich sag jetzt nur mehr noch: ich kann dem Leben weder eine Seelenlosigkeit noch eine Unintelligenz attestieren. --80.108.60.158 10:53, 15. Feb. 2014 (CET)
Da sind wir uns sicher einig. Und manches kann man auch nicht verstehen, weil es den Verstand (und aktuellen Wissensstand) übersteigt. Das geht ja schon los damit, sich Unendlichkeit vorzustellen - wir können eben nur in unseren menschlichen begrenzten Kategorien fühlen, denken, verstehen und erfinden, und irgendwo zwischen Mathematik und Philosophie ist dann Sense, da bleibt dann nur noch die Poesie. --87.167.242.85 11:11, 15. Feb. 2014 (CET)
man stelle sich eine Eisenkugel in der Größe der Erde vor, welche alle 1000 Jahre von einer Fliege besucht wird. Durch den kurzen Besuch der Fliege - sie landet lediglich und fliegt wieder weg - ensteht eine Reibung, eine minimale Abnutzung. Und dann wenn durch die Reibung, der Fliege, diese Kugel verschwunden ist, dann, dann hat die Ewigkeit noch nicht einmal angefangen. (entlehnt aus einem Mathematikbuch über eines deren Rätsel) --80.108.60.158 11:25, 15. Feb. 2014 (CET)
Hmmmm eine Eisenkugel von der Grösse der Erde (heiss in der Mitte?) - dann kann ich mir auch eine Fliege (woher kommt die? Aus dem Weltraum?), besser Weltraumfliege vorstellen, die riesengross ist und Gamma-Blitze verschiesst - und gleich sieht die Sache schonmal anders aus... :-) GEEZER… nil nisi bene 11:43, 15. Feb. 2014 (CET)
In der Wissenschaft muss man mindestens einen Doktortitel haben, damit eine Aussage anerkannt wird, auch wenn es sich um den größten Stuss handelt. --80.108.60.158 11:55, 15. Feb. 2014 (CET)
"die Rede des Apostel Paulus am Aeropag" stellt eine Erklärung des Monotheismus gegenüber dem Vielgötterglauben dar. --80.108.60.158 10:41, 15. Feb. 2014 (CET)
Ich werde mal reinschauen. Aber meine Fragen beantwortet das alles jetzt noch nicht: Historische lokale Ursprünge oder Vorgänger von Jahwe? Und warum wird die Rolle des Zoroastrismus hinsichtlich M. allgemein in unserer Kultur so heruntergespielt und beinahe verheimlicht? PS: Falls sich hier Gläubige durch meine Fragen irgendwie angegriffen fühlen: Über die in Religionen enthaltene Weisheit und ihre möglichen positiven Auswirkungen für den Einzelnen habe ich nichts ausgesagt, mich interessieren hier nur ihre historischen Ursprünge jenseits der religiösen Mythen, als Form von Kultur. --87.167.242.85 10:50, 15. Feb. 2014 (CET)
Klingt alles ein wenig nach "straw man"-Argument. Jeder, der sich ernsthaft mit Religion beschäftigt, gläubig oder nicht, weiß um die komplizierten Entstehungs- und Entwicklungszusammenhänge. Dass man von christlicher Seite früher nicht gerne über Zoroastrismus sprach, liegt theologisch wohl am eingebauten Dualismus (netter Gott plus Spaßverderber), den man innerhalb des Christentums schon früh als Häresie verfolgte, machtpolitisch wohl am zeitweise beeindruckenden Erfolg des Manichäertums. Einen philosophischen Monotheismus gab es auch bei Griechen und Römern, in (meist) friedlicher Koexistenz mit Staatskult und Mythos (die Athener fanden Paulus ganz amüsant, bis er an die Stelle mit Auferstehung und ewigem Leben kam). Umgekehrt hatte es sich die katholische und orthodoxe Kirche lange gemütlich mit einem folkloristischen Heiligenkult eingerichtet, der sicher polytheistische Tendenzen zeigte. Dass man in der Schule nicht alles lernt und manches Falsche, ist eine Binsenweisheit. Es ist schon viel gewonnen, wenn man lesen gelernt hat. Dann bleibt einem bei entsprechendem Interesse nur übrig, zeitlebens weiterhin Bücher zu lesen - oder wenigstens Wikipedia ;) (Monotheismus, JHWH, Zoroastrismus etc.). Grüße Dumbox (Diskussion) 11:07, 15. Feb. 2014 (CET)
Das sind dann die theologischen Feinheiten (ich weiß, wegen so etwas gab es Kriege). Aber wo ist da der straw man? Im Laufe meiner persönlichen Allgemeinbildung habe ich von Monotheismus immer nur im Zusammenhang mit den großen 3 Buchreligionen gelesen, bzw. speziell mit dem Judentum als ältester der drei. Von Zoroastrismus war nie die Rede, Zaratusthra nur im Zusammenhang mit Nietzsche ein Begriff. Ich kam nur aus Neugier auf den, weil ich das komische Symbol mal gesehen hatte. Und dann großes Aha-Erlebnis. Und da wären wir auch wieder bei meiner Frage, denn den Artikel JHWH habe ich zb. mit als erstes gelesen. Er ist aber eher interessant aus (binnen)religiöser Sicht, und weniger aus der Sicht zb. eines Kulturwissenschaftlers, den Ursprung, Vorlufer, Entwicklung so einer Gottesvorstellung interessieren (da sind die anderen Artikel zum Jerusalemer Tempel etc. sehr viel gewinnbringender). Liegt das am religiösen Tabu? Wenn man etwa den schon nahezu polemischen Artikel zur Kabaa damit vergleicht (heidnische Ursprünge der Kaaba sind ja auch beliebtes Motiv der polemischen sog. "Islamkritiker), so ist mit das erste, das man dort erfährt, der Bruch eines islamischen Tabus (vgl. auch Allatkult und Mohammeds "satanische Verse" ebendort). Da wird also, was ich richtig finde, auf religiöse Befindlichkeiten keine Rücksicht genommen, im Dienste der Wissenschaft und enzyklopädischen Wahrheitsfindung. Dann würde ich mir aber eben auch im JHHW-Artikel einen Abschnitt "historische Entwicklung" wünschen, dann hätte ich hier gar nicht erst nachfragen müssen. Wie gesagt, diesbezügliche Forschung gibt es ja, m.W. Links würden mir schon reichen. --87.167.242.85 11:33, 15. Feb. 2014 (CET)
Im Übrigen scheint die Bibel die Möglichkeit der Existenz der anderen Götter nicht mal zu verneinen. "Du sollst keine anderen Götter neben mir haben" - das kann man auch so deuten, dass es andere Götter geben kann, die aber keine Autorität für den Menscen sein dürfen. Und was ist mit dem Verbot, die Namen anderer Götter auszusprechen? Es gibt da noch einige Stellen, die man als "Konkurrenz" zu anderen Göttern deuten kann.--Alexmagnus Fragen? 11:23, 15. Feb. 2014 (CET)
Da findet sich total viel. U.a. las ich gestern fasziniert, dass in Jerusalem nach 1, 2 Königen der Monotheismus wieder abgemeldet war und Baaltempel etc. errichtet wurden. Weshalb im religiösen Mythos Gott dann erzürnt ist und ankündigt, Jerusalem nicht mehr als sein Haus anzusehen und zu zerstören. Oder Mohammed in Mekka, die sog. "Satanischen Verse" (durch die Rushdie bekannt wurde), und die Frage, ob Allah anfangs zwei Töchter hatte (ich glaube Allat und al-Uzza, also zwei alte Göttinnen). Oder die "Eherne Schlange" von Moses und der Äskulapstab - da vermischt und beeinflusst sich doch sehr viel gegenseitig, was heute eher als strikt getrennt angesehen wird, besonders natürlich von den jeweiligen heutigen Gläubigen. Und für Moslems sind ja wiederum die heilige Dreifaltigkeit oder die Vorstellung, dass Gott einen Sohn zeugt, unannehmbar und fast heidnisch. Und wegen sowas gibts dann Kriege, auch heute noch! --87.167.242.85 11:44, 15. Feb. 2014 (CET)
Zum relativen (primus inter pares-)Monotheismus (JHWH und die Konkurrenz, oder auch Aton) haben wir auch den Artikel Monolatrie. --Zerolevel (Diskussion) 15:28, 15. Feb. 2014 (CET)
Wer gern eine literarisch überformte Theorie der Entstehung des Monotheismus auf dem Diskussionsstand der damaligen Religionsgeschichte lesen möchte, dem kann ich Thomas Manns Josephsroman sehr ans Herz legen. --Hermine Tuzzi (Diskussion) 15:34, 15. Feb. 2014 (CET)
Genau genommen sind Juden- und Christentum nicht monotheistisch sondern monolatristisch. Sehr schön deutlich wird das beim sogenannten "Landtag zu Sichem", auf dem Josua die Stämme Israels vor die Frage stellt, welchem Gott / welchen Göttern sie zukünftig dienen wollen (Jos 24,1-28 EU). In dieselbe Richtung weisen auch der bereits erwähnte Dekalog sowie zahlreiche weitere Stellen, die den Gott Israels gegenüber anderen Gottheiten abgrenzend definieren: Gott Abrahams, Isaaks und Jakobs; Gott Israels; Gott, der Israel aus Ägypten geführt hat; Gott, der Himmel und Erde erschaffen hat; Gott, der Herr der Heerscharen; Gott, erhoben über alle Götter; "Wo ist solch ein Gott wie du, der die Sünde vergibt und erlässt die Schuld seines Volkes?" etc, etc - NT: Gott, der Vater unseres Herrn Jesus Christus; etc. Auffällig ist in diesem Zusammenhang ohnehin, dass die allgemeine Bezeichnung "Gott" (El, Elohim) immer eines Zusatzes bedarf, damit klar wird, welcher Gott gemeint ist. mfg,Gregor Helms (Diskussion) 15:59, 15. Feb. 2014 (CET)
Monolatristisch trifft es genau. Der Begriff "Kirche" ist zudem Auslegungssache. --80.108.60.158 16:42, 15. Feb. 2014 (CET)
Man sollte religionsgeschichtliche Erkenntnisse nicht mit Theologie vermengen. Also, allerspätestens seit Nicäa bekennen Christen den einen Gott, der alles geschaffen hat, die sichtbare und die unsichtbare Welt. Das schließt prinzipiell nicht die Existenz von Geistwesen aus, aber schon ihren Status als Götter im engeren Sinne. Grüße Dumbox (Diskussion) 17:05, 15. Feb. 2014 (CET)
Du vergisst, dass die altkirchlichen Bekenntnisse sich primär "innerchtistlich" abgrenzen, etwa gegenüber dem Arianismus etc. Ihr Absicht ist nicht, sich zu dem einen Gott angesichts vieler Götter zu bekennen, sondern den einen Gott in seiner Trinität angesichts der verschiedenen häretischen Strömungen (insbesondere innerhalb der Christologie). Das Nicänum (und ebenfalls die anderen Glaubensbekenntnisse) haben dennoch etwas Monolatristisches, was in dem Credimus (credo) in hörbar wird. Hier wird nicht gesagt: "Ich glaube, dass nur ein Gott existiert!" sondern: "Ich glaube an (im Sinne von vertaue auf) den einen Gott, der Himmel und Erde erschaffen hat ...". Dreimal heißt es in den Glaubenskenntnissen "Credo in" (Gott, Jesus Christus, Hl. Geist). Beim Thema Kirche, Gemeinschaft der Heiligen etc fehlt das in. Credo müsste hier, um Missverständnisse zu vermeiden, besser übersetzt werden mit "Ich glaube eine .... Kirche" (im Sinne von ich halte sie für wahr"). mfg, Gregor Helms (Diskussion) 18:26, 15. Feb. 2014 (CET)
Na ja, das "in" für die Kirche "fehlt" nur im Lateinischen, im griechischen Text steht es brav. Grüße Dumbox (Diskussion) 18:43, 15. Feb. 2014 (CET) Weil wir gerade dabei sind, "credere in" geht klassisch eigentlich gar nicht; im Sinne von "vertrauen auf" müsste da ein Dativ kommen. Ohne das jetzt nachprüfen zu können, gehe ich von einer Analogiekonstruktion zu gr. "pisteuein eis" aus, was Menge-Güthling als (neutestamentlich) "glauben an" führt. Interessantes Thema übrigens; da gibt's bestimmt massenhaft Literatur, wenn man mal Zeit hat... ;) Grüße Dumbox (Diskussion) 18:58, 15. Feb. 2014 (CET)
wenn wir beim biblischen Monotheismus bleiben, ergibt sich ebenso eine Trinität, welche sich in den drei abrahamitischen Religionen manifestieren. Jede dieser Stämme, oder Völker, oder wie auch immer man diese unterbelichteten Streithanseln benennen will glaubt nun an eine Gottheit, oder bzw einen Gott. Dem Einen und Einzigen. Aus Ihren Blickwinkeln der Betrachtung heraus, ergibt sich ein Bild. Zitat: 1Kor 13,9 Denn unser Wissen ist Stückwerk und unser prophetisches Reden ist Stückwerk. 1Kor 13,10 Wenn aber kommen wird das Vollkommene, so wird das Stückwerk aufhören. --80.108.60.158 18:39, 15. Feb. 2014 (CET) (habt ihr gewusst, dass in der Tür der Kabaa (Mekka) Teile des Goldes vom herodianischen Tempels von Jerusalem eingebaut sind. *Angeblich* Und die Kabaa - also der VorgängerAltar - wurde von Abraham errichtet.)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 10:13, 18. Feb. 2014 (CET)

Club of Budapest, ungarische Webseite

Was will uns bitte diese ungarische Webseite sagen: http://clubofbudapest.org/ - gibt es den Club of Budapest nicht mehr? - das hätte sich dann in die en und de Wikipedia noch nicht herumgesprochen. --Cholo Aleman (Diskussion) 11:45, 15. Feb. 2014 (CET)

Die französische Webseite ist noch online: http://www.clubdebudapest.org/index.php --Mauerquadrant (Diskussion) 12:34, 15. Feb. 2014 (CET)
Da steht, dass die Seite gerade umgestaltet wird ("Átrendezés alatt"). Wird allerdings bei mir nur im IE angezeigt, Chrome zeigt nur weiß. Grüße Dumbox (Diskussion) 12:42, 15. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 10:13, 18. Feb. 2014 (CET)

Wieviele sterben jeden Tag?

(nicht signierter Beitrag von 2001:4c28:4000:721:185:26:182:38 (Diskussion | Beiträge))
Google => wieviele menschen sterben pro tag weltweit <= Bei Giraffen sind es bedeutend weniger. GEEZER… nil nisi bene 17:36, 15. Feb. 2014 (CET)

Überschlägig lässt sich das berechnen, indem Du die Bevölkerungszahl des betreffenden Gebiets durch die Lebenserwartung in diesem Gebiet teilst. Für Deutschland sind das ca. Menschen pro Tag. --Rôtkæppchen68 17:55, 15. Feb. 2014 (CET)
Etwas ausführlicher und mit hübchen Grafiken: xkcd If one randomly chosen extra person were to die each second somewhere on Earth, what impact would it have on the world population? -- southpark 17:57, 15. Feb. 2014 (CET)
Leicht zu recherchierende Daten stehen in jedem Statistischen Jahrbuch. Schon im CIA Factbook findest du für jedes Land Geburten und Todesfälle pro 1000 Einwohner, einfach mit der Gesamteinwohnerzahl und dem Zeitraum verrechnen.--Antemister (Diskussion) 22:37, 15. Feb. 2014 (CET)
viel interessanteres in der Frage ich erblicke: wie viele gehen ohne spektakuläres aufsehen. --80.108.60.158 05:19, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:21, 19. Feb. 2014 (CET)

Löschen von eingescanntem QR-Code

Ich habe mit meinem Nokia Lumia 520 schon einige QR-Codes eingescannt. Nun möchte ich sie wieder entfernen, was einfach nicht klappt. Was muss ich tun?--92.208.193.242 18:43, 15. Feb. 2014 (CET)

--92.208.193.242 18:43, 15. Feb. 2014 (CET)

Dieser leicht ergoogelte Forumseintrag erklärt es Dir. --Rôtkæppchen68 18:59, 15. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 10:14, 18. Feb. 2014 (CET)

Android-Emulator für Windows XP

Ich würde gerne wissen, wer von euch so einen verwendet und wie zufrieden er damit ist. --Jack User (Diskussion) 19:34, 15. Feb. 2014 (CET)

Komische allgemeine Wissensfrage, aber ich verwende den Emulator aus dem Android-SDK (wenn auch eher unter neueren Windows-Systemen oder Linux) und bin im allgemeinen sehr zufrieden. -- Jonathan 20:46, 15. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 10:15, 18. Feb. 2014 (CET)

Buch durchsuchen und raus kopieren

Hallo kann man ein dickes Buch mit 400 Seiten irgendwie nach Wörtern durchsuchen? Ich habe eines zum Geburtstag geschenkt bekommen aus Papier und mit Bildern. Ohne scannen. (nicht signierter Beitrag von 2001:4C28:4000:721:185:26:182:38 (Diskussion | Beiträge) 21:09, 15. Feb. 2014 (CET))

Lesen soll gerüchteweise in solchen Fällen funktionieren. --88.130.139.20 21:16, 15. Feb. 2014 (CET)
Und das Herauskopieren nannten wir schreiben. Damals. 85.180.199.82 21:18, 15. Feb. 2014 (CET)
Nein, normal durchsuchen damit man nicht alles lesen muss. Das geht ja überhaupt nicht. Man findet garnichts. 2001:4C28:4000:721:185:26:182:38 21:23, 15. Feb. 2014 (CET)
Einscannen, Texterkennung drüber laufen lassen und fertig. --91.0.146.78 21
27, 15. Feb. 2014 (CET)
OHNE scannen hab ich gesagt. Das dauert ewig. 2001:4C28:4000:721:185:26:182:38 21:29, 15. Feb. 2014 (CET)
eBuch-Version kaufen, die kann man prima durchsuchen. --88.130.139.20 21:39, 15. Feb. 2014 (CET)
Abfotografieren. Wenn es gemeinfrei (urheberrechtlich nicht geschützt ist): Aus dem Internet herunterladen. --BlackEyedLion (Diskussion) 21:40, 15. Feb. 2014 (CET)
In google books suchen..--Belsazar (Diskussion) 21:45, 15. Feb. 2014 (CET)
Einen Dummen suchen, der das Lesen und Herausschreiben für dich erledigt. 85.180.199.82 22:00, 15. Feb. 2014 (CET)

Definitiv Kulturbanause, ignorieren, dammit. Gr., redNoise (Diskussion) 22:07, 15. Feb. 2014 (CET)

GoogleBooks, sofern es gescannt wurde (bzw Hathitrust). Und ansonsten den Verleger verfluchen wenn der kein Stichwortverzeichnis reinsetzt.--Antemister (Diskussion) 22:22, 15. Feb. 2014 (CET)
400 Seiten ≠ Dick !!! 89.0.92.212 00:43, 16. Feb. 2014 (CET)
Dicke ist relativ. Einem Literaten erscheinen 400 Seiten dünn, einem Lesefaulen dick. --Rôtkæppchen68 00:47, 16. Feb. 2014 (CET)
Ist noch jemandem der völlige Aberwitz der Frage aufgefallen? So deutlich ist mir noch nie ins Gesicht geknallt, dass das Internet alles verändert hat. (und zwar nicht nur zum Guten...) O tempora, o mores ;-) Solaris3 (Diskussion) 01:49, 16. Feb. 2014 (CET)
Nimm es als das, was es wohl ist: Ein trolliges und amüsantes Nutzen eines Klischees... 89.0.92.212 02:00, 16. Feb. 2014 (CET)
Troll-Sphäre und Realität verschwimmen hier aber regelmäßig. "Trolle als Indikatoren des kollektiven Unbewussten" oder so ;-) Solaris3 (Diskussion) 02:26, 16. Feb. 2014 (CET)
Ach, so lange wir - und im Idealfall der Troll - das noch merken... :-) 78.35.57.233 03:02, 16. Feb. 2014 (CET)
Klar geht das: man stellt jemanden mit einem eidetischen Gedächtnis als persönliches Faktotum ein; der liest dann das Buch und den fragt man dann einfach. Dürfte allerdings ziemlich teuer sein, denn wer stellt sich schon freiwillig für sowas zur Verfügung, wenn der Ertrag nicht wirklich bedeutend ist. Chiron McAnndra (Diskussion) 08:25, 16. Feb. 2014 (CET)

Ich würde einfach alle ISBN aus dem Buch zusammen mit dem gewünschten Suchwort mal bei der Google Websuche eingeben. --84.74.139.84 09:22, 16. Feb. 2014 (CET)

Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 10:15, 18. Feb. 2014 (CET)

Referenz-Nummer an Überweisungsautomat

Bei den Überweisungsautomaten ist seit Umstellung auf IBAN über den beiden Zeilen für "Verwendungszweck" eine weitere mit dem Titel Referenz-Nummer. Was hat es damit auf sich? Ist das ein zusätzliches Verwendugszweck-Feld? --91.0.146.78 21:54, 15. Feb. 2014 (CET)

Siehe hier Seite 2 Ziffer 3. --Rôtkæppchen68 22:15, 15. Feb. 2014 (CET)
Danke, aber mein PC kann derzeit leider keine PDF anzeigen, ist das ein zusätzliches Verwendungszweck-Feld? --91.0.146.78 22:27, 15. Feb. 2014 (CET)
„In das Feld [Referenz] geben Sie nur dann Daten ein, wenn diese vom Zahlungsempfänger z. B. wie in einer Rechnung angegeben, verlangt werden. Ansonsten lassen Sie dieses Feld einfach frei.“ Ich verstehe übrigens nicht, dass die angebotenen 140 Zeichen für den Verwendungszweck nicht ausreichen. Schreib dem Empfänger ein Email, wenn Du mehr zu sagen hast. Das ist billiger. --Rôtkæppchen68 22:39, 15. Feb. 2014 (CET)
Wer gewerbsmäßig Zahlungen empfängt muss sowieso mit allen erdenklichen Fehlformatierungen der Abwicklungsnummer rechnen. Was man in welches Feld reinzuschreiben hat, bestimmt einzig und allein derjenige, der diese Felder auswertet. Das ist nicht die Bank, sondern dein Geschäftspartner. Frag dort. -- Janka (Diskussion) 23:00, 15. Feb. 2014 (CET)
(BK) Ach so, danke. Die 140 Zeichen reichen locker, mir war nur der Sinn dieses Feldes nicht bewußt. Ich habe bisher dort Rechnungs- und Kindennummer eingetragen und dann im Verwendungszweck nochmals, weil ich mir nicht sicher war, ob das reicht (z.B. weil der Inhalt dieses neuen Feldes was Bankinternes ist und dem Empfänger nicht bekannt gegeben wird). --91.0.146.78 23:02, 15. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 10:16, 18. Feb. 2014 (CET)

Sensorschalter à la Stargate

Bei Stargate Atlantis bestehen die Schalter zum Betätigen der Türöffnungsfunktion aus einem Feld von drei "Lämpchen" und man muss lediglich in kurzer Entfernung davor die Hand rauf oder runter bewegen und schon geht die Tür auf. Soetwas müßte sich doch relativ einfach als Schalter umsetzen lassen - im Grunde so ähnlich wie Sensorschalter, die man kurz antippt, um das Licht ein- oder auszuschalten (oder gar zu dimmen). Es müßte nur eben optisch arbeiten und in einer Entfernung zwischen 0,5 und 10cm funktionieren. Und kompakter als die Stargate-Version sollte es auch sein - also nicht größer als ein normaler Schalter. Gibt es soetwas schon? Falls ja: wo? Falls nein: sind hier Elektronik-Leute, die soetwas bauen könnten? Chiron McAnndra (Diskussion) 08:18, 16. Feb. 2014 (CET)

Wäre es nicht noch eleganter, wenn sich die Tür schon öffnen würde, wenn man sich nur (aus einer bestimmten Richtung) nähert? Wenn man z.B. beide Hände voll hat? GEEZER… nil nisi bene 09:05, 16. Feb. 2014 (CET)
Sorry, aber ich suche NICHT nach einer Türöffnerfunktion (mal abgesehen davon wie dämlich es wäre, wenn im Flur jedesmal alle Türen aufgehen, an denen man lediglich vorbeigehen will), sondern nach einem Schalter - ich will selbst entscheiden, was ich damit schalten will. Mir geht es primär um Licht. Chiron McAnndra (Diskussion) 09:14, 16. Feb. 2014 (CET)
ich ich ich... :-) ich benutz sowas grad als Tastatur... Kapazitiver Sensor... Kapazitätsmultiplizierer... --Heimschützenzentrum (?) 09:16, 16. Feb. 2014 (CET) da: n filmchen... --Heimschützenzentrum (?) 09:28, 16. Feb. 2014 (CET)
Das gibt es im Sanitärgroßhandel als automatische Urinalspülung. Umbau auf Türöffner bitte selber machen. --Rôtkæppchen68 11:30, 16. Feb. 2014 (CET)

Schau bei conrad.de (z.b.) unter "Sensoren". Da gibt's alles --RobTorgel (Diskussion) 11:53, 16. Feb. 2014 (CET)


Nein, das funzt nicht optisch, sondern kapazitiv. Dafür gibt es fertige Chips im Preisbereich um 1€ herum. [41] -- Janka (Diskussion) 12:36, 16. Feb. 2014 (CET)

  • Hier muss man schon unterschieden. Die Lämpchen müssen gar nichts mit dem Schaltvorgang zu tun haben. Sondern rein zu Zierde angebracht sein, damit man weiss wo man mit der Hand zu wedeln hat. Annäherungssensoren usw. übernehmen dann den effektiven Schaltvorgang. Ob die dann auf kapazitiver Basis oder Infrarot arbeiten ist mehr dem Anwendungsbereich geschuldet. Aber es gibt etliche Schaltermodul auf dem Mark die bei Annäherung der Hand (oder anderes Körperteil) von 10-30 cm schalten, bzw. wenn sich der Körper wieder aus dem Überwachungsbereich endfernt (z.B. Pissior-Spülung). --Bobo11 (Diskussion) 12:46, 16. Feb. 2014 (CET)
@Janka, für den geforderten Betätigungsabstand sind kapazitive Näherungsschalter aus dem Handybereich eher ungeeignet. Passende Reflexlichtschranken gibt es aber auch für kleines Geld.[42] --Rôtkæppchen68 12:57, 16. Feb. 2014 (CET)
Nein, das funzt hervorragend auch im Abstand einiger Zentimeter. Ich musste damit kämpfen, die Dinger *unempfindlicher* zu bekommen. Das hängt hauptsächlich von der Größe der Elektrode und der Massefläche ab -> je grober die Struktur der Elektrode, desto größer der mögliche Bedienabstand. Guck dir mal die Datenblätter der QT60160 an, da steht was zum Elektrodendesign, außerdem hat der Chip ein halbes Dutzend einstellbare Parameter je Taste. -- Janka (Diskussion) 14:03, 16. Feb. 2014 (CET)
Radar gibt's übrigens auch noch. Ich habe hier etliche Mini-Radarmodule, die aus Urinalspülungen stammen. -- Janka (Diskussion) 14:06, 16. Feb. 2014 (CET)
Radar dürfte bei Urinalspülungen auch sinnvoll sein. Ich erinnere mich noch an die Infrarotspülungen, die wir vor ca. 20 Jahren im neueingeweihten Unigebäude in Stuttgart in der Breitwiesenstraße[43] hatten: Die sprachen bei mir nie an, weil ich immer ein schwarzes T-Shirt trug. --Rôtkæppchen68 14:13, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:21, 19. Feb. 2014 (CET)

Eishockey-Frage

Hallo, hier meine Frage: Muss eigentlich der (Jahres-)Meister einer Eishockey-Liga ebenfalls in die Play-Offs oder steigt der immer automatisch in die nächst höhere Liga auf??

--79.225.98.101 11:25, 16. Feb. 2014 (CET)

Sorry, hätte zuerst hier schauen sollen. Frage somit erledigt!! (Gesichtet muss es aber noch werden!) --79.225.98.101 11:51, 16. Feb. 2014 (CET)

Archivierung dieses Abschnittes wurde gewünscht von: feloscho [schreib' mir was]; 17:47, 18. Feb. 2014 (CET)

Niederländische Einkommensteuer bei Vermietungseinkünften

Ich habe gerade gelernt, daß Vermieter in den Niederlanden nicht die erhaltene Miete (minus Werbungskosten, z.B. Kreditzinsen, Abschreibung etc.) versteuern, sondern 30% von 4% vom Verkehrswert (WOZ-Waarde), also praktisch eine Vermögensteuer von 1,2% unabhängig von der Miete. Daraus drei Fragen: 1. Ist das zutreffend? 2. Wer baut dann überhaupt Mietwohnungen in den Niederlanden? 3. Gibt es eine Möglichkeit, zu einer - der deutschen ähnlichen - Einkünftebesteuerung zu kommen? --80.129.146.215 14:05, 16. Feb. 2014 (CET)

Schau mal in dieser PDF [44] auf Seite 13, dort steht das vom Verkehrswert erstmal alle Schulden abgezogen und davon dann erst die 1,2% berechnet werden (sofern ichs nicht falsch verstehe) --Lidius (Diskussion) 15:43, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:22, 19. Feb. 2014 (CET)

Anerkennung der ZJ als KdöR

Warum haben eigentlich die Zeugen Jehovas gerichtlich darum gestritten, als Körperschaft des öffentlichen Rechts anerkannt zu werden? Auf einige ihnen damit zustehende Privilegien hätten sie ja laut unserer Darstellung sogar verzichtet, aber worum ging es ihnen dabei sonst? --Blauer Berg (Diskussion) 14:40, 16. Feb. 2014 (CET)

Steht hier. Sie haben dann einen Status wie die Grossen. GEEZER… nil nisi bene 15:18, 16. Feb. 2014 (CET)
Wo genau auf der Seite ist die Antwort auf meine Frage? Die Zeichenkette "Grossen" finde ich dort nicht... --Blauer Berg (Diskussion) 15:33, 16. Feb. 2014 (CET)
Auf Verdacht, ganz am Anfang: So seien etwa nur Spenden an anerkannte Kirchen und Religionsgesellschaften steuerlich absetzbar. Diskriminierungen seien auch durch das "teilweise staatlich geförderte Sektenstigma" gegeben. Die Vorführung von "Anti-Sekten-Videos" an Schulen etwa führe oftmals zu verbalen und sogar tätlichen Angriffen auf Kinder von Zeugen Jehovas. Gegen diese Benachteiligungen setzt sich die Gemeinschaft.. zur Wehr. -- southpark 15:41, 16. Feb. 2014 (CET)
Danke! --Blauer Berg (Diskussion) 15:58, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:23, 19. Feb. 2014 (CET)

Frage aus dem Hüttenwesen

Es geht um die Übersetzung einer Bibelstelle: kann man das Entfernen des Werkbleis bei der Läuterung von Edelmetallen als abziehen bezeichnen? Falls nein, welches Wort nimmt man da am besten? --Hermine Tuzzi (Diskussion) 15:39, 16. Feb. 2014 (CET)

Unser Artikel Kupellation bietet die Synonyme Läuterung, Abtreiben oder Treibarbeit. --Rôtkæppchen68 15:47, 16. Feb. 2014 (CET)
Es geht mir speziell um den Vorgang, bei dem das Werkblei nach der Scheidung vom geläuterten Edelmetall weggenommen wird; laut Kupellation wird es normalerweise von der Kupelle aufgesogen; der Wortlaut der zu übersetzenden Stelle läßt aber vermuten, daß eine aktive Tätigkeit vonnöten ist, um das Werkblei zu entfernen. Laut Güldischsilber schwimmt die Oxydschicht bei der Läuterung obenauf -- soweit ich aus der Schule noch zu wissen glaube, kann man eine solche Schicht dann abstreifen, was fachsprachlich abziehen genannt wird. Liege ich da technisch richtig?
Beim abtreiben weiß ich nicht, worauf sich dieses Verb bezieht: Treibt man Silber von Werkblei ab oder Werkblei von Silber? --Hermine Tuzzi (Diskussion) 15:54, 16. Feb. 2014 (CET)
„Abgezogen“ wird demzufolge wohl eher das Silber. --84.178.15.167 16:08, 16. Feb. 2014 (CET)
Könnte man denken, aber die dortige Website irrt sich: Silberglätte <= Wikipedia irrt sich nicht ... nie... neverever ! ;-)) GEEZER… nil nisi bene 16:15, 16. Feb. 2014 (CET)
synonym zu abziehen kommt bei mir ein abschöpfen. --80.108.60.158 16:25, 16. Feb. 2014 (CET)
Könnte man denken, aber analog dem Vorgang hier (auch Vorseite lesen) wird die kruspelige Oxidschicht mit einem Holz - der Krempel ist ja noch relativ heiss/warm - abgezogen. GEEZER… nil nisi bene 16:31, 16. Feb. 2014 (CET)
du hast jetzt nur nach deinem Begriff gesucht, oder? --80.108.60.158 16:36, 16. Feb. 2014 (CET)
Könnte man denken, aber ich habe nach dem realen Vorgang gesucht: Wie passiert dieses Abziehen. Das scheint ein gängiger Begriff in der Metallurgie zu sein - warum sollte man den ändern wollen? Es erhält die Authenzität. Ich weiss nicht, für wen Hermine welchen Text schreibt... GEEZER… nil nisi bene 16:42, 16. Feb. 2014 (CET)
wenn sie eine Bibelstelle übersetzt, nehme ich an, dass das Industriezeitalter mit einer Massenfertigung und seinen Fertigungstechniken noch nicht so bekannt war. Deshalb habe ich das abschöpfen von einer Art Erdtopf vor Augen. --80.108.60.158 16:45, 16. Feb. 2014 (CET)
Einen lockernen Feststoff (Bleioxid) von einem harten Feststoff (Blei, Silber etc.) "abschöpfen"..? Hmmmm.
Springer schreibt:"... geschmolzene Blei Luft aufgeblasen und die entstehende Bleiglätte (Bleioxid) ständig abgestrichen..." GEEZER… nil nisi bene 16:53, 16. Feb. 2014 (CET)
In einem Topf schöpft man auch ein Fett ab! --80.108.60.158 16:55, 16. Feb. 2014 (CET)
Ich stelle mir den Vorgang so vor, daß eine oben schwimmende Masse entweder aus dem Schmelztiegel ausgegossen wird (paßt hier nicht zum Wortlaut), oder daß sie mit einem latten- oder kremmerförmigen Gegenstand weggeschoben und über den Rand aus dem (schräg gehaltenen?) Tiegel befördert wird. Beim Abschöpfen hätte ich eher eine Kelle im Kopf, in die man die oben schwimmende Masse laufen läßt, um sie aus dem Tiegel zu heben; bei dieser Methode würde nach meinem Verständnis aber notwendigerweise auch viel Silber mit abgeschöpft, was ja unerwünscht ist -- und das Schöpfgerät würde wohl bei der hohen Temperatur in Mitleidenschaft gezogen werden. --Hermine Tuzzi (Diskussion) 18:18, 16. Feb. 2014 (CET)
wenn ich keinen Schöpfer habe, dann nehme ich dir auch deinen Tiegel. Das zur Seite schieben, also abziehen, ist schon klar. Das abschöpfen auch. Vielleicht wurde es aber auch eher hinausgeschossen?? Aber wir hatten damals kaum bis wenig hartes Metall zum verhütten. Das Eisen kam erst später. --80.108.60.158 18:24, 16. Feb. 2014 (CET)
Geezer, das ist famos! Im Text steht stagnum, was i. allg. eine stehende oder langsam abfließende Flüssigkeit bedeutet, hier also wahrscheinlich die Oxydschicht, die oben auf dem Blicksilber schwimmt. Die Wörterbücher geben für stagnum ‚Werkblei‘ an, eine Mischung aus Silber und Blei, und beziehen sich u. a. auf Plinius d. Ä.; es scheint sich aber an dieser Stelle in der Vulgata, wo am Ende lauteres Metall übrigbleibt, wo es also um das eigentliche Treiben geht, tatsächlich um die oben schwimmende Silberglätte zu handeln. Sehr interessant! --Hermine Tuzzi (Diskussion) 17:46, 16. Feb. 2014 (CET)
Freut mich, wenn es etwas gebracht hat! Hermine ist Heavy-Metal-Kennerin! Wer hätte das gedacht ... der Tag hat sich gelohnt..! GEEZER… nil nisi bene 17:53, 16. Feb. 2014 (CET)
Hermine kommt aus einem ehemaligen Eisenerzfördergebiet und hat dort viel, viel Heimatkundeunterricht genossen. Die Stelle, um die es sich handelt, ist übrigens Jes 1,25 VUL. Vielen Dank allen für die sachdienlichen Hinweise! --Hermine Tuzzi (Diskussion) 18:18, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:23, 19. Feb. 2014 (CET)

Will Freeman (About a Boy

ich würde gerne wissen, ob jemand von euch einen song kennt, der gut zu Will Freeman aus About A Boy passt. Will mmüsste sich mit ihm gut identifizieren können.

--Hansköppke (Diskussion) 16:12, 16. Feb. 2014 (CET)

Schau mal hier: About a Boy Original Motion Picture Soundtrack --Search and Rescue (Diskussion) 16:25, 16. Feb. 2014 (CET)
Oder lies das Buch da gibt es ganz andere Musik die leider nicht in den Film übernommen wurde. --Mauerquadrant (Diskussion) 17:19, 16. Feb. 2014 (CET)
Ob er sich mit dem Lied identifizieren kann, weiß ich nicht, aber sein Charakter wird u.a. von Carly Simon in "you're so vain" besungen.--Wikiseidank (Diskussion) 17:56, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:24, 19. Feb. 2014 (CET)

Browser funktionieren nicht mehr nach Microsoft Windows Security Update

Nach einem Zwangs-Update (für Vista) funktionieren Firefox 26 und IE 9.08 nicht mehr. Firefox bringt die Meldung „Server nicht gefunden.“ IE ebenfalls. Netzwerkdiagnose bei IE ergibt: „Es wurden keine Probleme … gefunden.“ Nachdem ich das Betriebssystem mit einer früheren Version wieder hergestellt habe, funktioniert zwar IE aber bei Firefox kommt die Fehlermeldung „Couldn’t load XPCOM.“ Selbst wenn ich Firefox neu installiere, kommt die Meldung „Server nicht gefunden.“ Was ist da los und vor allem: Was kann/muss ich tun, damit Firefox wieder läuft? Und: Wie kann ich die Zwangs-Updates, die jetzt kommen abstellen? Vielen Dank im Voraus! Brunswyk (Diskussion) 17:36, 16. Feb. 2014 (CET)

Siehe Wikipedia:Suchhilfe/Archiv/2014/02/03#Firefox blockiert und https://support.mozilla.org/de/questions/974209 . --Rôtkæppchen68 18:02, 16. Feb. 2014 (CET)
Updates, die Du nicht haben willst, blendest Du über deren Kontextmenü aus. --Rôtkæppchen68 18:04, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:24, 19. Feb. 2014 (CET)

Archivieren von Emails im Outlook

Ich möchte gerne meine Mails, die ich (von verschiedenen Mailkonten) im Outlook habe, so sichern, dass sie nicht mehr verloren gehen können, wenn sie z.B. der Mailanbieter so standardmässig löscht. Dass sie also unabhängig von Synchronisierung sicher sind, nicht mehr einfach verschwinden können... Das nennt man dann wohl archivieren, oder? Und das ganze gerne möglichst einfach, also auch für Technik unaffine Menschen (=mich) ausführbar... Über Antworten würde ich mich sehr freuen. Danke und herzliche Grüsse --Marca2011 (Diskussion) 18:07, 16. Feb. 2014 (CET)

Du hast sicher schon den Punkt Archivieren… im Datei-Menü entdeckt. --Rôtkæppchen68 18:24, 16. Feb. 2014 (CET)
Öhm... nein. *schäm*. Da gibt es nur einen Punkt "Postfach aufräumen", aber das ist nicht, was ich meine...--Marca2011 (Diskussion) 18:29, 16. Feb. 2014 (CET)
Dann hast Du wahrscheinlich eine andere Outlook-Version als ich. Ich hab Outlook 2007. --Rôtkæppchen68 18:34, 16. Feb. 2014 (CET)
Ja, es ist Outlook 2010. --Marca2011 (Diskussion) 19:09, 16. Feb. 2014 (CET)
Für Outlook 2010 geht das so. --Rôtkæppchen68 19:12, 16. Feb. 2014 (CET)
Danke. "Tools zum Aufräumen" find ich, nicht aber den Unterpunkt "Archivieren". Könnte das an dem liegen, was auf der verlinkten Hilfeseite steht? "Der Befehl und die Funktion Archivieren werden nicht für jedes Konto in Ihrem Outlook-Profil angezeigt, wenn Sie ein Exchange Server-Konto aufnehmen und Ihre Organisation Microsoft Exchange Server-Onlinearchiv verwendet. Diese Funktion kann auch von Ihrem Netzwerkadministrator deaktiviert werden." Ich habe vier Emailkonten, davon zwei von Gratis-Anbietern (u.a. gmx), zwei von Firmen - aber bei keinem der Konten gibt es einen Unterpunkt "Archivieren"... --Marca2011 (Diskussion) 19:21, 16. Feb. 2014 (CET)
Ist das ein Privat-PC oder ein Firmen-PC, der an eine NT-Domäne o.ä. angeschlossen ist? --Rôtkæppchen68 19:37, 16. Feb. 2014 (CET)
Das ist ein Privat-PC. Falls das wichtig ist: Die Email werden bei den Gratis-Anbietern via "IMAP/SMTP" abgerufen, bei den Firmen-Kontos einmal via "Microsoft Exchange", einmal via "POP/SMTP". Wobei es mir vor allem um die Archivierung jener Mails geht, die via "Microsoft Exchange" abgerufen werden. --Marca2011 (Diskussion) 19:45, 16. Feb. 2014 (CET)
Dann hat das wohl der Admin des Exchange-Servers abgestellt. Wenn ich mir das so durchlese, kann das durchaus gewollt sein. Hier hilft dann wohl nur Export der entsprechenden Mailboxen in eine lokale Datei, wie hier beschrieben. --Rôtkæppchen68 20:06, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:24, 19. Feb. 2014 (CET)

wasser grün blau

--87.149.72.226 20:11, 16. Feb. 2014 (CET) also mann hat ein dünnes Glas und ein blatt Papier mit blauer und grüner schrieft, wen man das glas drüberhält dann ist die blaue schrieft gedreht warum????

Das ist ein bekannter Zaubertrick: wenn man eine Schrift (egal welche Farbe) z.B. durch den Stiel eines Weinglases ("dünnes Glas") betrachtet (das Wort wird waagrecht gehalten und durch den ebenso waagrechte gehaltenen Stiel des Glases betrachtet), wird die Schrift den physikalischen Regeln der Reflexion entsprechend gespiegelt (auf den Kopf gestellt, oben unten vertauscht). Das Wort in grüner Schrift ist ein anderes Wort, als das in blauer Schrift, es besteht aber nur aus solchen Buchstaben, die auch nach Spiegelung genauso aussehen, z.B. "OXIDE", d.h. auch dieses Wort wird natürlich gespiegelt ("oben unten vertauscht") es fällt nur nicht auf. Die unterschiedliche Farbe der Wörter ist nur eine falsche Fährte zur Verwirrung. - StephanPsy (Diskussion) 22:26, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:25, 19. Feb. 2014 (CET)

Reimage Repair?

Mein Windows XP funzt angeblich nicht richtig (hab ich noch nicht gemerkt). Nach Anklicken der Meldung zwecks Reparatur taucht =>http://de.reimageplus.com/lp/sys/index.php?tracking=con&banner=nonet&adgroup=direct&ads_name=direct&keyword=direct auf und fordert zum Download auf. Ist diese Software a)jemandem bekannt b)brauchbar oder c)möglicherweise schädlich? Avira sagt bisher nix, vielleicht später beim downloaden oder Ausführen. Für gute Ratschläge dankt --82.82.173.218 20:19, 16. Feb. 2014 (CET)

Der, der das behauptet, ist vermutlich Malware. Also das nicht runterladen und stattdessen den Virus loswerden. --Eike (Diskussion) 20:23, 16. Feb. 2014 (CET)
Über Reimage selbst und seinen Nutzen kann ich dir nichts sagen. Aber ein einfacher Realitätscheck: Hast du ein 3rd-party-Programm beauftragt, in deinem Betriebssystem herumzuschnüffeln? Wenn nicht, dann ist das Malware. Wenn es gar nicht geschnüffelt hat, sondern nur so tut, dann ist es Scareware. So oder so gibt es keinen vernünftigen Grund, auf den Download-Knopf zu drücken. Grüße Dumbox (Diskussion) 21:43, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:25, 19. Feb. 2014 (CET)

Anwendung

--2A02:120B:2C72:C7B0:1961:A0F3:A736:EB31 20:37, 16. Feb. 2014 (CET)

Und wie lautet Deine Frage…?Spuki Séance 20:38, 16. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: Trotz Nachhaken keine Wissensfrage erkennbar. --Rôtkæppchen68 00:23, 19. Feb. 2014 (CET)

Google Earth - Meeresflächen

Weiß jemand von euch, warum bei Google Earth/Maps die Meeresflächen alle verpixelt sind, auch solche in unmittelbarer Küstennähe wo vorgelagerte kleine Inseln und Atolle allein vom Bildausschnitt sicher mit auf dem zu Grunde liegenden Satellitenfoto mit drauf waren? Ca. einen halben Kilometer von der Küste entfernt sind die Bilder immer beschnitten. Nur wenn eine Insel eine gewissen Größe hat, wird sie von dem automatischen Verpixeln ausgespart, kleinere Inseln sind unscharf oder verschwinden einfach. Beispiele: die Schlangeninsel vor dem Donaudelta, die San-Blas-Inseln an der Nordostküste Panamas, ein paar ganz kleinen Inseln der Grenadinen (zB Petite Canouan), etc. --El bes (Diskussion) 14:11, 15. Feb. 2014 (CET)

Das dürfte daran liegen, weil es im Meer nur geringe Unterschiede in der Helligkeit und keine deutlichen Kontraste gibt. Der Datenstrom vom Server, dürfte daher auf dem Grafikformat "JPG" beruhen. Inseln, Landmassen, sowie ausgewählte Gebiete, werden zudem in einer höheren Auflösung bereitgestellt, weil der Meeresboden ja uninteressant ist. Meistens ist die Auflösung an Land nur so, dass man gerade mal einen Menschen als solchen erkennen kann. Es gibt aber auch ein paar wenige Bereiche, bei denen man sogar Kaffeetassen auf Tischen erkennen kann. Die Übergänge dazwischen erscheinen dann als Linien, weil diese Bereiche stark unterschiedliche Farbdarstellungen haben. Die Farben in den hohen Auflösungen, sind irgendwie ins grau verschoben. --Sassenburger (Diskussion) 14:31, 15. Feb. 2014 (CET)
Hast du mal schnell Koordinaten einer solchen Kaffeetasse? Würde ich mir gerne mal ansehen. --Jobu0101 (Diskussion) 16:59, 15. Feb. 2014 (CET)
Beispiel: 51°30'49,45"N, 7°28'00,30"O, aufgenommen 4.2.2005. Könnte u.U. auch eine Cola-Flasche o.ä. sein, aber in dem Bereich liegt die Auflösung beispielsweise bei 10cm und darunter. --Proofreader (Diskussion) 23:25, 15. Feb. 2014 (CET)
Ich wäre übrigens immer noch dankbar für eine Antwort von jemand der sich auskennt. --El bes (Diskussion) 18:38, 15. Feb. 2014 (CET)
@Sassenburger, hast Du Dir die Meere und die Übergänge Land–Meer bei Google Earth mal genau abgeschaut? Luft- und Satellitenfotos des Meeres siehst Du bei Google Earth nur in unmittelbarer Küstennähe, der Rest des Meeres ist wie auf einer physischen Karte entsprechend der Meerestiefe unterschiedlich blau gefärbt. Kleinere Inseln müssten extra überflogen werden, um scharfe Luftbilder zu gewinnen. Deswegen sieht man da meist nur unscharfe Satellitenbilder. --Rôtkæppchen68 19:14, 15. Feb. 2014 (CET)
Gehört vermutlich nicht zu den üblichen Kundenwünschen aber Google hat auch sowas im Angebot. Wenn es dich vertiefend interessiert findest du sicher genügend Material unter Verwendung des englischen Fachbegriffs "bathymetry". --Kharon 02:18, 16. Feb. 2014 (CET)

Fasse zusammen: keiner weiß eine Antwort auf meine Frage. Schade. --El bes (Diskussion) 20:23, 16. Feb. 2014 (CET)

Falsch. Rôtkæppchen68 hat es doch schön beschrieben... zoome einfach mal raus und du siehst eine bathymetrische Karte. Dafür muss im Meer natürlich die fotografische Darstellung der Wasseroberfläche getilgt werden. Und wo dies nicht der Fall ist, die Auflösung aber trotzdem schlecht ist, da gibt es einfach keine besseren Aufnahmen. --тнояsтеn 10:13, 17. Feb. 2014 (CET)
Ich will nicht den Meeresgrund sehen, sondern Inseln. Und warum Google Earth die vorhandenen Bilder in einem fixen Abstand vor der Küste abschneidet und nur größere Inseln ausgespart werden (kleinere erkennt die Software offenbar nicht), wurde nicht erklärt. Satellitenfotos und Laufaufnahmen sind ja in der Regel rechteckig. Weshalb man da ein Eck abschneidet in dem sich noch eine winzige Insel befindet, konnte nicht erklärt werden. --El bes (Diskussion) 11:43, 17. Feb. 2014 (CET)
Du hast es dir doch schon selbst erklärt: um die bathymetrische Karte darstellen zu können, wird die Luftaufnahme "in einem fixen Abstand vor der Küste" gekappt. It's not a bug, it's a feature. --тнояsтеn 13:03, 17. Feb. 2014 (CET)
Oder probiere NASA World Wind aus. Da kannst du unter verschiedenen Satteliten/Quellen/Datenbanken auswählen. --Kharon 16:41, 17. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:37, 20. Feb. 2014 (CET)

Kosten für Rechtsanwalt

Gestern wurde mein Job zum 31. März gekündigt. Die Kündigung ist meiner Meinung nach ungerecht. Die Kosten für einen Anwalt machen mir Angst, da ich nicht viel verdiene und keine Rechtschutzversicherung habe. Was kostet es, wenn ich einen Rechtsanwalt einschalte? Sollte ich mir Angebote von verschiedenen Anwälten holen? MfG Katharina R. (nicht signierter Beitrag von 82.113.98.27 (Diskussion) 18:57, 15. Feb. 2014 (CET))

Rechtshinweis Bitte den Hinweis zu Rechtsthemen beachten!
Prozesskostenhilfe... den Antrag kann der Anwalt stellen... die Anwälte sind alle gleich teuer (BRAGO), außer man vereinbart ein Sonderhonorar... Vorm Arbeitsgericht kann man sich auch selbst vertreten (dann übernimmt der Richter ein bisschen die Rolle des Anwalts...)... Viel Erfolg... --Heimschützenzentrum (?) 19:03, 15. Feb. 2014 (CET)
gibt es in D. so etwas wie eine Arbeiterkammer oder einen Volksanwalt? --80.108.60.158 19:06, 15. Feb. 2014 (CET)
Beim Arbeitsgericht gibt's kostenlose Rechtsberatung. Arbeiterkammer??? Gibt's wohl nicht, es sei denn, damit ist die Gewerkschaft gemeint. -- Gerd (Diskussion) 19:12, 15. Feb. 2014 (CET)
Service: Kammer für Arbeiter und Angestellte in Österreich. Eine "gesetzliche Interessenvertretung der Arbeitnehmer" gibts in D nicht. Wo kämen wir denn da hin? ;-) Österreich ist uns doch in so manchem voraus... Solaris3 (Diskussion) 19:32, 15. Feb. 2014 (CET)
(BK) Die BRAGO ist vor 10! Jahren durch das RVG abgelöst worden. Nur als kleiner Hinweis ;-) --Lidius (Diskussion) 19:36, 15. Feb. 2014 (CET)
Beratungsschein holen, den Anwalt seines Vertrauens beauftragen und schnell, sehr schnell vor Gericht gehen. Solche Klagen müssen innerhalb von drei (!) Wochen eingereicht werden, siehe dazu Kündigungsschutzklage. --Jack User (Diskussion) 19:40, 15. Feb. 2014 (CET)
Ganz so schlimm ist es in Deutschland denn doch nicht. :-) Service 2: Es gibt die Arbeitskammer des Saarlandes und die Arbeitnehmerkammer Bremen. --Stefan1973HB Disk. 19:51, 15. Feb. 2014 (CET)
Im übrigen gibt es vor dem Arbeitsgericht keinen Anwaltszwang, man kann sich auch selber vertreten, aber man muss eben ziemlich schnell sein. --Jack User (Diskussion) 19:41, 15. Feb. 2014 (CET)
so rasch wie möglich einen fundierten Einwand erheben. --80.108.60.158 05:15, 16. Feb. 2014 (CET)
(BK) Bedenke, dass statistisch gesehen 90 Prozent der Arbeitsrechtsfälle als Vergleich enden. Der Arbeitgeber hat wie Du ohne PKH einen Monatslohn als Kosten für das Verfahren zu tragen und kann sich im Arbeitszeugnis oder Rückfragen des neuen Arbeitgebers darüber auslassen. Sollte das Arbeitsverhältnis fortbestehen, wirst Du nur geduldet sein und keine Möglichkeit der Abmahnung ausgelassen werden. Sollte die Kündigung gegen bestehendes Recht verstoßen, sieht vieles anders aus. --Hans Haase (有问题吗) 13:40, 17. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:38, 20. Feb. 2014 (CET)

Handelsabkommen Deutschland/Schweiz

Ich möchte wissen, ob das Handelsabkommen den Schweizern erlaubt, mir zu verbieten Essensauslieferungen in die Schweiz zu tätigen.

--Stengele67 (Diskussion) 20:39, 15. Feb. 2014 (CET)

Die Schweiz ist nicht im EWR, sprich du bist verpflichte deine Ware zu verzollen. Und da die Verzollung bei Gewerbetreibenden, seit der 2014 gültigen Weisung ausdrücklich nur nach vor gängiger elektronischer Voranmeldung und während Bürozeiten möglich ist. Ist die zollkonforme kurzfristige Ausliefern von Take-Away Produkten so gut wie unmöglich. --Bobo11 (Diskussion) 22:00, 15. Feb. 2014 (CET)
So ist es. Dieser und dieser aktuelle Artikel widmet sich dem Thema. Laut Eidgenössischem Finanzdepartement war die entsprechende Regelung in den letzten Jahren "stillschweigend außer Kraft gesetzt" und soll nun - sehr zum Leidwesen der deutschen Lieferdienste - wieder angewendet werden. --Joyborg 12:47, 17. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:38, 20. Feb. 2014 (CET)

Windows: Kommandozeilenprogramm nach dem Beenden nicht schließen

Liebe Auskunft, ich habe eine ausführbare Datei, die Text auf die Kommandozeile ausgibt. Wenn das Programm beendet wird, schließt sich das Fenster. Das möchte ich verhindern und das Fenster offen lassen. Die Eingabeaufforderung (cmd.exe) ist auf dem Rechner allerdings gesperrt, sodass die Verwendung von cmd.exe /k nicht möglich ist. In Windows 95 gab es wohl bei den Eigenschaften der Datei eine entsprechende Einstellung. Gibt es Alternativen in Windows XP und 7? Vielen Dank für Antworten! --BlackEyedLion (Diskussion) 20:54, 15. Feb. 2014 (CET)

Käme in Frage, das Programm mit einer Batch-Datei aufzurufen und danach pause einzufügen? —[ˈjøːˌmaˑ] 21:00, 15. Feb. 2014 (CET)
Wahrscheinlich nicht: Batch-Dateien werden wohl in cmd.exe ausgeführt. (Das Fenster sieht gleich aus, aber in der Titelzeile steht cmd.exe, bei exe-Dateien dagegen der Name der Datei.) --BlackEyedLion (Diskussion) 21:22, 15. Feb. 2014 (CET)
Probiere es mit der Pause-Taste kurz bevor die Ausführung des Programms zuende ist. Dazu muss das Fenster aktiv sein. Das ist extrem fummelig. --Rôtkæppchen68 22:45, 15. Feb. 2014 (CET)
Ich weiß nicht, wann das Programm beendet wird. Es geht vor allem darum, Fehlermeldungen zu sehen. --BlackEyedLion (Diskussion) 00:18, 16. Feb. 2014 (CET)

Kannst du mit Pipe (Informatik) die Ausgabe in eine Datei umleiten? Schreib mal hinter deinen Programmaufruf  | datei.txt --Mauerquadrant (Diskussion) 22:53, 15. Feb. 2014 (CET)

Bei Windows geht die Umleitung der Ausgabe in eine Date mit >: Programm.exe >Ausgabe.txt. Dazu ist aber cmd.exe erforderlich. In einem Startmenüobjekt geht das nicht, eben ausprobiert. --Rôtkæppchen68 22:58, 15. Feb. 2014 (CET)
Ich bin nicht sicher, die Frage richtig zu verstehen, aber: Wenn ich per rechter Maustaste und Drag&Drop unter XP eine Verknüpfung zu einer DOS-Echse (ist hier mein Missverständnis?) anlege, erhält deren "Eigenschaften"-Fenster die Registerkarte "Programm" - und hier kann ich verhindern, dass das Fenster nach Beenden geschlossen wird... 89.0.92.212 01:02, 16. Feb. 2014 (CET)
Man könnte es lösen, indem nach Ablauf der Ausgabe eine Eingabe abgefragt wird. Der Text der Eingabezeile wird dann per Command-Befehl dem Commandointerpreter zugeschoben - und das in einer Schleife. Chiron McAnndra (Diskussion) 08:32, 16. Feb. 2014 (CET)
Das funktioniert hier leider nicht: „Die Eingabeaufforderung (cmd.exe) ist auf dem Rechner allerdings gesperrt“. --Rôtkæppchen68 13:02, 16. Feb. 2014 (CET)
@89.0.92.212: Du hast die Frage wohl richtig verstanden. Ich habe aber keinen Reiter "Programm". Die Reiter heißen Allgemein, Verknüpfung, Optionen, Schriftart, Layout, Farben, Kompatibilität und Sicherheit. Das Betriebssystem ist Windows XP Professional 2002 SP 3. --84.151.146.254 23:17, 16. Feb. 2014 (CET)
Auf jeden Fall funktioniert am Ende der Batchdatei den Befehl pause einzufügen. Als Alternative gibt es nach meiner Erinnerung noch den Parameter /k (o.s.ä.: vgl. cmd.exe /?), der an "geeigneter Stelle" der Verknüpfung angegeben werden kann. Genauer kann ich's leider nicht beschreiben, da ich mein XP schon länger nicht mehr gebootet habe. --grixlkraxl (Diskussion) 09:26, 17. Feb. 2014 (CET)
Siehe auch: start /wait und Pipes > datei.txt, zum Anhängen: >> datei.txt oder < eingabe.txt --Hans Haase (有问题吗) 13:58, 17. Feb. 2014 (CET)
start /w hab ich schon erfolglos getestet. Vielleicht hätte ich schreiben sollen, dass das nicht funzt. Das lässt nur den aufrufenden Prozess bis zur Beendigung des Programms warten. Ein- und Ausgabeumleitung funktiojniert ohne cmd.exe auch nicht. Da Benutzer:BlackEyedLion an den Fehlermeldungen interessiert ist, wäre hier sowieso eine Umleitung der Standardfehlerausgabe stderr sinnvoll, bei cmd.exe geht das mit Programm.exe 2>Fehlerausgabe.txt. --Rôtkæppchen68 14:04, 17. Feb. 2014 (CET)
Wäre nicht ein einfacher Wrapper möglich? Also ein Program, welches das eigentlich auszuführende Programm aufruft und dessen stdout- und stderr-Streams abfängt? --Filzstift  15:03, 17. Feb. 2014 (CET)
PS: Hatte in Erinnerung, so was zu haben und das jetzt gefunden. Bei Interesse kann ich dir, @BlackEyedLion:, ein .NET-Progrämmchen, der das tut, zustellen. Mit "chkdsk", "tasklist" und dergleichen funktionierts jedenfalls. --Filzstift  15:17, 17. Feb. 2014 (CET)
Das ist bestimmt eine gute Lösung. Ein solches Programm kann ich mir auch selbst erstellen. --BlackEyedLion (Diskussion) 16:31, 17. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:40, 20. Feb. 2014 (CET)

Löhne und Preise in der Schweiz

Im Zuge der Einwanderungsdebatte ist mir dass mal bewusst aufgefallen, welche schwindelerregenden Gehälter in der Schweiz offenbar üblich sind. Hier (unpassender Artikel, habe den aber gerade zufällig da) heißt es etwa, unterstes Lohnniveau sei 50.000 €/Jahr - in Deutschland beginnt bei 52.000 € der Spitzensteuersatz! Wie geht das? Das Schweizer BIP/Einwohner liegt gerade mal 15 % über dem von Deutschland. (Ich weiß, die Schweiz ist teuer, sehr teuer sogar. Aber das kommt mir doch extrem vor).--Antemister (Diskussion) 23:17, 15. Feb. 2014 (CET)

Besonders hoch scheinen mir die Mieten zu sein, die immerhin einen großen Beitrag zu den Ausgaben liefern. Diese Wohnung [45] dürfte in Deutschland in ähnlicher Lage etwa halb so teuer sein. Auch beim Einkommen scheint mir ein Faktor von ungefähr 2 zu gelten. --BlackEyedLion (Diskussion) 00:14, 16. Feb. 2014 (CET)
Stopp: Ich fürchte du hast die Annonce die du verlinkt hast nicht wirklich gelesen. Den Preis würden wir für diese Wohnung auch bezahlen. Sie ist teilmöbliert mit vollständiger Küche. Gute Anbiundung und zentrale Lage. $ Zimmer 90 Quadratmeter. 1505 euro. Versuche eine solche Wohnung für weniger zentral in einer deutschen Großstadt zu bekommen und dir schlackern die Ohren. Der Preis ist durchaus passabel verglichen mit München. --Ironhoof (Diskussion) 05:37, 16. Feb. 2014 (CET)
mit München verglichen ist alles passabel. --El bes (Diskussion) 05:41, 16. Feb. 2014 (CET)
Die Antwort liegt schon im Vergleich. In Deutschland werden Arbeitnehmer schlicht tendenziell weit weniger am Unternehmensgewinn beteiligt. Schlimmer noch setzten sich in Deutschland, durch die forcierte Liberalisierungspolitik wie das implizit politisch geförderte Lohndumping, viele Geschäftsmodelle durch, die vorallem auf dem Rücken ihrer Arbeitnehmer oder Scheinselbstständigen Marktvorteile und -Anteile realisieren. Es gibt einen massiven kulturellen Unterschied, der als Spitze des Eisbergs regelmäßig in Form von krassesten Skandalen sichtbar wird, wie z.B. wenn bekannt wird das selbst deutsche Luxushotels ihre Zimmermädchen oder Putzkräften mit Löhnen von 3 € pro Stunde abspeisen. --Kharon 01:54, 16. Feb. 2014 (CET)
Das stimmt. Früher war der Unterschied zwischen der westdeutschen BRD und der Schweiz nicht so groß, besonders nicht in den angrenzenden süddeutschen Regionen. Damals waren Arbeitskräfte in der BRD auch noch knapp, der gewerkschaftliche Organisationsgrad hoch und die deutsche Industrie hatte noch keine Konkurrenz aus Osteuropa und Asien. Seit 1989 hat sich aber Deutschland stark verändert. 17 Million Ostdeutsche sind auf dem Arbeitsmarkt dazu gekommen, 2 bis 3 Millionen volksdeutsche Aussiedler, 4 Millionen Türken, die Jugoslawienkriege brachten weitere Einwanderung in den Billiglohnsektor, etc. Gleichzeitig wanderten arbeitsintensive und weniger technologieintensive Industriebereiche massiv ab, wodurch sich viel, viel mehr Arbeitnehmer um viel weniger Jobs streiten. Die wenigen Jobs die entstanden sind, sind in dem von dir Kharon beschriebenen Billiglohn-Dienstleistungssektor (Pizza ausliefern, Handyshop, Wettbüro, Kebapbude, Nagelmaniküre, Solarium, Fitnesscenter, etc.). Die Liberalisierungen und Hartz IV haben das ganze noch weiter nach unten gedrückt. So haben wir uns die "Dienstleistungsgesellschaft" nicht vorgestellt, als in den späten 1980er und frühen 1990er Jahren davon die Rede war. Die Schweiz ist in der selben Zeit ihre alte Wirtschaftspolitik weiter gefahren, durch Zölle und staatliche Regulierung verdient man dort auch im Dienstleistungssektor stattliche Gehälter. Das ist sozial gut für die Betroffenen, macht aber Dienstleistungen sehr teuer. Ein Hotelzimmer um 19,- Euro die Nacht oder eine Zustellpizza um 5,50 Euro wirst du dort nicht so leicht finden. Der Konsument bezahlt höhere Preise, damit die in diesen Branchen tätigen Angestellten nicht verarmen und am Hungertuch nagen. Dafür braucht der schweizer Staat weniger Transferleistungen bezahlen, weil diese Leute sich selbst finanzieren können. So können auch die Steuern niedriger sein. Das alles funktioniert aber nur, so lange der schweizer Arbeitsmarkt ein wenig abgeschlossen ist und nicht komplett offen und der Zuzug von ausländischen Arbeitskräften sich in begrenzten Bahnen hält. So versteht man auch leicht, weshalb die Schweizer vor einer Woche so abgestimmt haben, wie sie abgestimmt haben. Mit EU-Beitritt und vollkommener Personenfreizügigkeit müsste die Schweiz mittelfristig ihr ganzen System, ja ihren impliziten Gesellschaftsvertrag komplett umstellen, was de facto eine Nivellieurung der sozialen Standards nach unten, auf das Niveau der Nachbarländer Deutschland, Frankreich und Italien bedeuten würde. Dann kriegt die Putzfrau keine vier Tusig Stutze mehr, wenn täglich ein paar Tausend Billiglohn-Pendler aus Norditalien ins Tessin putzen und Zimmer aufräumen kommen. --El bes (Diskussion) 02:42, 16. Feb. 2014 (CET)
Genau richtig erkannt El Bes. Ich sehe das auch so, dass das Ja vor allem deswegen zustande gekommen ist, weil die Ausländer für weniger Geld arbeiten kommen. Ich kenne da genügend die von Deutschland auf eine Arbeitsstelle gemeldet haben, und dann auf die Welt kamen und sich fragten warum sie mit ihrem Lohn in der Schweiz nicht über die Runden kommen. Aber das sie es selber waren, die das Lohnniveau gedrückt hatten, darauf kamen sie oft nicht wirklich selber. Auch in der Schweiz stagnierten in den letzten Jahren die meisten Löhne aber die Kosten für Wohnung und Krankenkasse siegen. Wenn da eben nicht Gegensteuer gegeben wird (Udn das wurde mit der Abstimmung) kriegen wir wirklich die selben Verhältnisse wie in Europa. Wo ein nicht zu Verachtender Anteil der Leute nicht mal von ihrer Arbeit leben kann (wenn sie denn überhaupt noch Arbeit finden).--Bobo11 (Diskussion) 13:06, 16. Feb. 2014 (CET)
Das Wahlvolk hat entschieden, die Drecksarbeit zukünftig lieber wieder selber zu übernehmen, auf Arzttermine länger zu warten sowie für diverse andere Dienstleistungen eben etwas mehr zu bezahlen, und nimmt dafür langfristig sogar AHV-Kürzungen in Kauf. Dafür darf es dann auch dem Nicht-Wahlvolk die "Spiesse kürzen", wie es so schön heisst. --Blauer Berg (Diskussion) 15:09, 16. Feb. 2014 (CET)
In jeder entwickelten Gesellschaft, gibt es genug junge Leute, die sich für den Arztberuf interessieren und auch diesen Berufsweg einschlagen wollen, wenn die Studienbedingungen passen und man nach der Uni einen Job findet und das Salär einigermaßen ok ist und einem vor lauter Überstunden das Privatleben nicht vollkommen ruiniert wird. Es gibt genug junge Schweizer, die Arzt werden wollen. Und wenn das Angebot passt, übernehmen sie auch gern eine Praxis in Oberhinterwaldbrunzhausen in Appenzell-Innerhoden. Kurzfristige Löcher (zu viele freie Arztstellen, zu wenig Absolventen) hat allein die Politik zu verantworten. --El bes (Diskussion) 20:22, 16. Feb. 2014 (CET)
In einer Gesellschaft (und wenn sie noch so gut entwickelt sein mag), in der man als Arzt einen sehr viel geringeren Vorsprung an Einkommen und Ansehen hat, als es in anderen Gesellschaften der Fall ist, findet sich eben einfach nicht genügend Nachwuchs, der diese langwierige und auch nicht gerade einfache Ausbildung in Kauf nehmen mag. Ist ja auch eine ganz pragmatische Entscheidung. Schätzungen zufolge müßte die Schweiz zwischen 1200 und 1300 Ärzte pro Jahr ausbilden, um den Bedarf selbst zu decken. Dies bedeutet eine Steigerung der Ausbildungsabschlüsse gegenüber den heutigen Abschlusszahlen von 700 - 800 pro Jahr um rund 40 Prozent. --Blauer Berg (Diskussion) 09:44, 17. Feb. 2014 (CET)
Österreich hat bei ungefähr gleich großer Wohnbevölkerung wie die Schweiz jährlich etwa 1800 Medizinabsolventen. Wenn die Schweiz tatsächlich nur 700 bis 800 jährlich hat, dann ist mit den Unis dort was nicht in Ordnung, aber grob. --El bes (Diskussion) 19:27, 17. Feb. 2014 (CET)
Warum sollte es an den Unis liegen, wenn man in Österreich als Arzt beispielsweise gegenüber einem Landwirt einfach viel mehr verdient und auch ein höheres gesellschaftliches Ansehen genießt, als es in der Schweiz der Fall ist? --84.74.139.84 17:46, 18. Feb. 2014 (CET)
Direkterer, weniger politischer Ansatz zur Beantwortung der Frage: In der Schweiz ist im Vergleich zu Deutschland nicht nur der Lohn höher, sondern auch die durchschnittliche Wochenarbeitszeit, und dafür gibt es weniger Feiertage und weniger Urlaub. Der Schweizer Arbeitnehmer arbeitet also auch mehr für sein Geld, und dafür wandert ein höherer Anteil von den Gesamtlohnkosten in seine Tasche, weil die Lohnnebenkosten niedriger sind. Der Arbeitgeber zahlt also für dieselbe Arbeit nicht so viel mehr als das am Ende den Eindruck macht. --YMS (Diskussion) 21:09, 16. Feb. 2014 (CET)
Nachdem sich El bes, Bobo11 und YMS zum "schwindelerregenden" (Fragesteller) Thema der (Kritik der) Politischen Ökonomie auf enzyklopädisch geäussert haben, ergänze ich einen Hinweis auf einen deutsch und schweizerischen Text. Wobei mir das diffizile Verhältnis zwischen Ernsthaftigkeit und Humor bewusst ist. Allaaf und Hellau. --grixlkraxl (Diskussion) 10:06, 17. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:41, 20. Feb. 2014 (CET)

Umwandlung WMA in MP3

Hallo.

Wie kann ich am einfachsten Lieder die in WMA Format sind auf Format MP3 umwandeln. Danke für die Hilfe.

Gruß--2A02:908:E038:CB00:B0D2:A948:31E9:446E 10:25, 16. Feb. 2014 (CET)

am einfachsten - und besten - mit einem Codierer welcher eine Lame 3.99 codierung aufweist.
"Max" für Windows, und XLD für Macintosh
(ich möchte aber darauf hinweisen, dass eine mp4 Codierung bei der Absicht es zu streamen diverse Vorteile haben dürfte - siehe Airplay) --80.108.60.158 11:15, 16. Feb. 2014 (CET)
Mit google kommt man drauf. --91.0.153.21 11:18, 16. Feb. 2014 (CET)

Mit dem VLC Mediaplayer dürfte es auch gehen. Zuerst Medien-Konvertieren-Speichern wählen. Dann Hinzufügen anklicken und eine DAtei auswählen. Nochmal Konvertieren-Speichern auswählen. Bei Profil "Audio-MP3" auswählen. Namen der ZIeldatei eingeben. Speichern,Start drücken.--79.224.223.36 15:57, 16. Feb. 2014 (CET)

Ich nutze hierzu die Kommandozeilenversion von LAME. Allerdings sehe ich keinen Nutzen in einer Wandlung von WMA nach MP3. Kompression und Qualität von WMA und MP3 sind vergleichbar, jede Transcodierung vermindert die Qualität der Audiodatei. --Rôtkæppchen68 16:22, 16. Feb. 2014 (CET)
Vielleicht kann sein MP3-Player nur MP3? Übrigens halte ich es für zweifelhaft, dass jede Transcodierung die Qualität mindert. Wenn man zwischen Original und Kodiertem bei guter Kodierung keinen Unterschied hört - sollte das für die Kodierung von Kodiertem nicht erst recht gelten? Ich hab das auch, allerdings mit MP3 zu MP3 zu MP3, mal getestet. Nach einem Einschwingvorgang (7 Runden oder so) war das Ergebnis sogar binär identisch zum Vorgänger. Ob das mit Transcodierungen auch klappen würde, weiß ich aber nicht. --Eike (Diskussion) 16:32, 16. Feb. 2014 (CET)
Das kannst Du ganz einfach selbst ausprobieren: Nimm ein beliebiges Musikstück, Kompressionseinstellungen nach freier Wahl und komprimiere dann das Stück mit dem von dir gewählten Kompressionsalgorithmus 1000 Mal hintereinander und höre Dir das Ergebnis an. --Rôtkæppchen68 17:19, 16. Feb. 2014 (CET)
Wie gesagt: Mit MP3 habe ich das getan und nach etwas sieben Rekodierungen waren alle folgenden binär identisch zum Vorgänger (also das tausendste wie das siebte). --Eike (Diskussion) 17:28, 16. Feb. 2014 (CET)
Dann hab ich die falschen MP3-Encoder (Fraunhofer/Radium und Lame). --Rôtkæppchen68 18:06, 16. Feb. 2014 (CET)
eine geignete Hilfestellung wäre eine Spectralanalyse. --80.108.60.158 19:07, 16. Feb. 2014 (CET)
Hilfe für... was? --Eike (Diskussion) 19:08, 16. Feb. 2014 (CET)
so, wie es im 'Artikel mp3', Abschnitt "Verfahren", in den Bildern dargestellt wird, kann man anhand einer Spektralanalyse eine optische Visualisierung des Ergebnisses heranziehen, ob auch eine klangvolle und voluminöse Codierung stattgefunden hat. Alleine die Bitrate verrät .... --80.108.60.158 19:15, 16. Feb. 2014 (CET)
Das braucht's nicht. Wenn Rotkaeppchen recht hat, hört man das, und wenn ich Recht hab, sieht man's am Diff. --Eike (Diskussion) 19:34, 16. Feb. 2014 (CET)
schon OK. So viel Mühe muss ich mir keine machen. Mein Ehrgeiz bezieht sich da auf ganz andere Qualitäten. Und ich bezeichne mich als Audiophil. --80.108.60.158 19:51, 16. Feb. 2014 (CET)
Ich hab's jetzt mal mit Lame probiert, und da wird es tatsächlich jede Runde schlechter und seltsamerweise auch leiser. Ich weiß leider nicht mehr, welchen Encoder ich damals verwendet hatte und find auch den Abschnitt im Archiv der Auskunft nicht. (Ich weiß aber auch nicht, ob ich da Details gepostet hatte.) --Eike (Diskussion) 19:59, 16. Feb. 2014 (CET)
Ich hab mich geirrt. Was ich probiert hatte, war, ein JPEG immer wieder zu kodieren: Wikipedia:Auskunft/Archiv/2011/Woche_44#Qualitätsverluste beim Editieren von .jpg --Eike (Diskussion) 20:16, 16. Feb. 2014 (CET)
Ich streue mir auch Asche aufs Haupt: Im Abschnitt Wikipedia:Auskunft/Archiv/2011/Woche 49#MP3 Bitrate wurde die Datei nur 50 Mal komprimiert. --Rôtkæppchen68 22:19, 16. Feb. 2014 (CET)
der Unterschied liegt wohl in der Absicht: der Versuch einer Transkodierung, und dem Versuch einer erneuten Komprimiereung. --80.108.60.158 04:40, 17. Feb. 2014 (CET)
zur Archivierung nehme ein Lossless Format. (Lossless bedeutet ohne Verlust. erkennt man mit einer Spectralanalyse sehr gut). Und für den täglichen Gebrauch nehme ein dir und deinen Geräten bevorzugtes Format. - wobei man auch bei den Latenzzeiten der Übertragung auf portable Player erhebliche Vorteile spüren kann, wenn man ein geeignetes Format für eine jeweilige Software-Architektur verwendet. --80.108.60.158 07:00, 17. Feb. 2014 (CET)
LAME kann über Audacity bedient werden, wer's mit GUI will. --Hans Haase (有问题吗) 11:46, 17. Feb. 2014 (CET)
Was ist denn die "Latenzzeit der Übertragung auf portable Player" und wo finde ich Informationen über dessen Software-Architektur? --Eike (Diskussion) 13:05, 17. Feb. 2014 (CET)
In unteren beiden Ergebnisse der Begriffserklärung (BKL) passen: Bei einem Codec ist eine Datenmenge notwendig, um ein Analogsignal zu generieren. Bei umkomprimiertem Audio genügt ein Sample (8 oder 16 Bit, um am AD-Wandler einen Spannungswert anzulegen. Komprimiertes Audio speichert den Verlauf der Spektren, nicht die einzelnen Samples. Diese Verzögerung ist die Latenz. Bei Mobiltelefonen auch mit ein Schutz vor Rückkopplung, siehe Verzögerung (Telekommunikation) und Laufzeit (Elektrotechnik), was den Signalweg ausmacht. --Hans Haase (有问题吗) 14:22, 17. Feb. 2014 (CET)
Es ging um die Übertragung, nicht ums Abspielen. --Eike (Diskussion) 14:33, 17. Feb. 2014 (CET)
<zu "Latenz" bzw "Software-Architektur"> Der Aufbau der zu Bearbeitung kommenden logischen Architekturen, können sich von BS zu BS (eventuell sogar Service-Packs) unterscheiden. Um den Ablauf von speichern lesen und schreiben kümmern sich die jeweiligen Aufbauten um den Prozessor herum. Innert der Übertragung auf externe Geräte kommt nun die Übertragungsrate und eventuell ein Funk-Standard zu tragen. Merke: ein starker Prozessor ist mit einer grottenschlecht geschriebenen Software seiner tatsächlich möglichen Stärke beraubt. Der Funkstandard wurde von Apple auf eine Übertragungsrate von 120 Mbit/s angehoben. So kann man auch eine verlustfreie ALAC-Datei locker streamen. (apropos: Alac ist freie Software und kleiner als eine FLAC-Datei) [http://support.apple.com/kb/ht4199 Wifi Standard) Wer mit verlustfreien Codes auf Apple zu tun hat, weiß was eine ausgereizte USB 2.0 kann, eine Firewire bewirkt, und was Thunderbolt verspricht. --80.108.60.158 14:41, 17. Feb. 2014 (CET)
Kann es sein, dass du in Sachen USB, Firewire und co Latenz mit Übertragungsgeschwindigkeit verwechselst? Falls nein: Wie misst du sie und in welcher Größenordnung steht sie im Vergleich zur Übertragung von Audiodateien? --Eike (Diskussion) 15:29, 17. Feb. 2014 (CET)
Für Audioübertragung in CD-Qualität reichen 1,5 Mb/s. HD-Audio braucht allerdings unkomprimiert bis zu 25 Mb/s. MP3 ohne Erweiterungen ist bis 0,32 Mb/s spezifiziert. Wenn Apple das WLAN auf 120 Mb/s aufbohrt, dann ist das eine proprietäre Erweiterung. Norm sind 54, 150 und 300 Mb/s und Vielfache von 150 Mb/s. --Rôtkæppchen68 16:02, 17. Feb. 2014 (CET)
die EIngangsfrage wurde ausreichend beantwortet. Und eine tierferführende Ausbildung könntest du bei mir für den übernächsten Sommer gegen Bezahlung bestellen --80.108.60.158 15:56, 17. Feb. 2014 (CET)
Schlag einfach mal Latenz nach. Die Latenz einer USB-Verbindung liegt sicherlich im Millisekundenbereich, vielleicht sogar darunter. Wie man da "auch bei den Latenzzeiten der Übertragung auf portable Player erhebliche Vorteile spüren kann, wenn man ein geeignetes Format für eine jeweilige Software-Architektur verwendet", bleibt dein Geheimnis. Um wieviele Mikrosekunden die wohl gesunken sein mag...? --Eike (Diskussion) 16:38, 17. Feb. 2014 (CET)
ich schlag nach: und fand unter Latenz: die Laufzeit eines Signals in einem technischen System, siehe Laufzeit (Elektrotechnik) --80.108.60.158 16:44, 17. Feb. 2014 (CET)
es geht bei mir kaum um Milisekunden wenn ich Gigabyte-Blöcke verarbeite, oder? --80.108.60.158 16:46, 17. Feb. 2014 (CET)
und wie eine Platte partitioniert wird, damit man besser und sicherer damit arbeiten kann ..... wollen wir noch tiefer unter dem Dreck unterm Teppich? --80.108.60.158 16:48, 17. Feb. 2014 (CET)
Du hast von der Latenzzeit gesprochen, und die bemisst sich halt in solchen Fällen in Millisekunden. Ich denke auch, dass das keine Rolle spielt, und schließe daraus, dass du gar keine Latenzzeiten meintest. (Latenzzeiten kennen viele Interessierte vom Netzwerk. Die Übertragungsrate mag 2, 16, 50 Mbit sein. Die Latenzzeit ("Ping-Zeit") ist im Bereich von 10, 20, 100ms. Und sie ist im Normalfall unabhängig von der übertragenen Datenmenge.) --Eike (Diskussion) 17:11, 17. Feb. 2014 (CET)
du hast eine fehlerhafte Brille auf: die Latenzzeit bezieht sich auf "ein Signal" von A nach B. Wenn von A gelesen wird, und auf B geschrieben wird, so muss das ganze Zusammenspiel passen. Denn die Schreib und Lesegeschwindigkeit ist wichtig, neben der Latenz. (als ob man mit einer einäugigen Pyramide quasselt.) --80.108.60.158 17:27, 17. Feb. 2014 (CET)
Ich habe die passenden Fragen dazu längst gestellt: Wie misst du deine Latenzzeit und in welcher Größenordnung steht sie im Vergleich zur Übertragung von Audiodateien? (Hint: Eine Audiodatei ist kein Signal.) Du drückst dich jetzt seit fünf Beiträgen um eine Antwort. Wenn du nicht in der Lage bist, darauf zu antworten, wird jedwedes Drumrumreden nicht weiterhelfen. Zahlen zählen, Mr. Watson. Ansonsten ist hier EOD. --Eike (Diskussion) 17:38, 17. Feb. 2014 (CET)
was soll das jetzt? Wenn du zu arrogant bist bei der klräung helfen zu können und mir nur mit haarspaltereien auf den sack gehst, dann formulierst du daraus einen Angriff auf deine Unzulänglichkeit, oder wie? EOD schon zuvor. Sie werden von mir PERSÖNLICH ignoriert. --80.108.60.158 17:41, 17. Feb. 2014 (CET)
ein Standard wird dadruch definiert, in dem er sich an eine "gesicherte" Übertragung in einem eingegrenzten Umfeld in einem zugelassenem Wert bewegt. Es gibt etliche starke Ansagen, und ums Eck lassen diese erheblich nach. Das ist Qualität erreicht durch einen Standard. --80.108.60.158 16:04, 17. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:41, 20. Feb. 2014 (CET)

Veganismus und Körperform

Hallo! Eine Bekannte ist bereits seit vergleichsweise früher Kindheit Vegetarierin, und inzwischen schon seit einigen Jahren auch Veganerin. Nun kann man sich trefflich darüber streiten, ob und wie sehr diese Ernährungsweise gesund ist, aber mehr oder weniger erwartungsgemäß ist sie ziemlich schlank, geradezu zierlich. Trotzdem hat sie aber ziemlich voluminöse Oberschenkel. Wie kommt sowas? Ich werde mich hüten, sie darauf anzusprechen ;-), und klar, Ferndiagnosen sind nicht möglich, will ich auch gar nicht. Aber da sie oberhalb der Hüfte wirklich mehr als nur einfach schlank ist, frage ich mich ganz grundsätzlich, wie es kommen kann, dass sich Körpervolumen so ungleichmäßig verteilt an nur einem Körperteil ansammelt. Und aufgrund ihrer Ernährungsweise kann ich mir irgendwie auch nicht vorstellen, dass das Fettpolster sein sollen. Ich habe mal irgendwo gelesen, dass zu salzarme Ernährung zu Wasserausschwemmungen in den Gliedmaßen führt, stimmt das? --92.229.74.175 13:33, 16. Feb. 2014 (CET)

Sehe keinen Zusammenhang. Ohne dir oder der Dame nähertreten zu wollen - es könnte auch eine Disposition zu einem Lipödem sein (GoogleBildersuche => Lipödem <= zeigt, dass es da Abstufungen gibt.) GEEZER… nil nisi bene 13:41, 16. Feb. 2014 (CET)
Muskeln? --Eike (Diskussion) 13:42, 16. Feb. 2014 (CET)
Lipodystrophie? --84.143.223.196 13:53, 16. Feb. 2014 (CET)
ich wundere mich auch immer wieder, dass ein ziemlich hoher Prozentsatz von der Norm abweicht. Was hält sie von Bulimie? -kleiner Scherz, sorry. Wobei die Norm an sich eher dürftig ausformuliert wurde. Das kann vielerlei Gründe haben. Zum einen Genetisch, oder auch mit der Arbeit (situations-bedingt). eventuell geht ihr eine größteils sitzende tätigkeit ...... dass gewisse Stoffe anders abgebaut werden. --80.108.60.158 14:39, 16. Feb. 2014 (CET)
Warum assoziiere ich jetzt einen Cartoon von Herman... ? GEEZER… nil nisi bene 15:22, 16. Feb. 2014 (CET)
Geezer: Exzellent. Grundsätzlich würde ich sagen: Von genau einem Fall darauf schließen zu wollen, ob das beobachtete Phänomen generell mit veganer Lebensweise korreliert ist, ist sehr unwissenschaftlich. Anders: Die Wahrscheinlichkeit, dass die großen Oberschenkel mit etwas völlig anderem zusammenhängen (Sport, genetische Anlagen, etc) ist so hoch, dass man dazu keine seriöse Aussage treffen kann. Solaris3 (Diskussion) 16:19, 16. Feb. 2014 (CET)
nahja. es gibt mW bei den Schwarzafrikanerinnen eine ziemliche ausgeprägte Form. (das hat sogar einen Namen) --80.108.60.158 16:23, 16. Feb. 2014 (CET)
Ahja. Und was möchtest du mit der Aussage beweisen? Dass die alle vegan leben? Oder gerade nicht? Oder wie? Solaris3 (Diskussion) 17:01, 16. Feb. 2014 (CET)
Zur Klärung einer Frage eine Artverwandte Begrifflichkeit aufzubringen stört dich Solaris3? --80.108.60.158 17:06, 16. Feb. 2014 (CET)
Laut Wiki ist das „femorale Adipositas (= Steatotrochanterie)“. --RobTorgel (Diskussion) 17:16, 16. Feb. 2014 (CET)
80.108.60.158 meinte wohl eher Steatopygie. --Rôtkæppchen68 17:21, 16. Feb. 2014 (CET)
Es gibt einfach Frauen vom Typ Haflinger (nicht von mir, aber gut). Welches Fremwort man nun verwenden will, finde ich wie gesagt sehr gewagt. Ihr kennt die Maßstäbe des Fragestellers nicht, vielleicht würdet ihr sie gar nicht als so oberschenkellastig einstufen. Aber meinetwegen ist die Chance höher, dass es zB typisch weibliche Reiterhosen sind, als das es mit veganer Lebensweise zu tun hat. Solaris3 (Diskussion) 17:40, 16. Feb. 2014 (CET)

Danke für die Antworten (und die kleinen Ausflüge typisch für die WP-Auskunft ;)…) Ohne sie jemals unbekleidet gesehen zu haben würde ich auf stark ausgeprägte „Reiterhosen“/Lipödem tippen. Wie in der Diskussion die Meinung aufkommen könnte, ich hielte ihren Veganismus für ursächlich dafür, ist mir allerdings vollkommen schleierhaft, mir war vielmehr unklar, wie es trotz Veganismus zu solchen Fettansammlungen kommen kann. Inzwischen habe ich den Artikel gelesen und bin schlauer, mit der Ernährung oder Übergewicht hat das also gar nichts zu tun. Nachdem ich das jetzt weiß, macht es mich nur um so trauriger. Sie ist eine junge, sehr hübsche Frau, wirklich sehr schlank und schmal, nur eben im Bereich der Hüften und Oberschenkel leider nicht. Kann man dagegen wirklich gar nichts tun? Im Artikel klingt es so („Es handelt sich um eine progrediente Erkrankung.“q), als würde es immer schlimmer werden, egal, was sie tut.--92.229.74.175 17:53, 16. Feb. 2014 (CET)

hüstel. bei Lipödem wird dies als Krankheit gewertet? Bei dem von mir angesprochenem Attribut weiblicher Farbiger ist dies mW sogar ab und zu ein Schönheitsmerkmal. Schwarzafrikaner denken wahrscheinlich anders wie wir. (liegt wohl an der Barbie der weißen) --80.108.60.158 18:00, 16. Feb. 2014 (CET)

Das hat ja nichts mit Schönheitsidealen zu tun, laut Artikel schadet es dem Lymphsystem und breitet sich unweigerlich über den ganzen Körper aus, außerdem scheint es schmerzhaft zu sein und zu Verletzungsnafälligkeit zu führen, ganz zu schweigen von eventuellen Folgeerkrankungen. Es ist schlicht ungesund.--92.229.74.175 18:02, 16. Feb. 2014 (CET)

die Lymphen kann man massieren. Kann schon sein das verschiedene Meridiane verlegt sind. Zumindest kann man über asiatische MassageKünste speziell auf die Lymphen einwirken. --80.108.60.158 18:05, 16. Feb. 2014 (CET)


Die Körperform hat bei einem gesunden Menschen nix mit der Ernährung zu tun sondern ist von den genen vorherbestimmt. Und Frauen haben halt an den Hüften, Beinen mehr masse, vielleicht macht sie ja auch Sport? Ich kenne auch viele Frauen die Superschlank sind aber trotzdem einen großen hintern haben. Ist halt so. Vielleicht spielt Neid auch eine Rolle? Gruß--78.51.225.178 14:55, 17. Feb. 2014 (CET)
Die Körperform hat sehr wohl mit der Ernährung zu tun. Man schaue sich nur einmal die typischen Figuren des Karrikaturisten Manfred Deix an. Er zeichnete in den 1970er und 80er Jahren die angefressene Nachkriegsgeneration in all ihren unschönen Facetten. Diese Leute waren aber von zu viel Fleisch und tierischem Fett selber fett geworden. Die Deix-Figuren haben Schnitzel, Blutwurst, Leberknödel, Schweinsbraten und dicke Knackwürste auf dem Teller und als Nachspeise immer Torte. Niemals aßen diese Leute Pommes Frittes, denn die gab es damals noch nicht. Auch wenn Deix ein wenig übertreibt, gab es in dieser Generation tatsächlich sehr viele solche Leute, Typ Fleischersgattin. Die waren am ganzen Körper rund, dicke Köpfe, dicke Hände, dicker Hals, alles dick, aber straff, schweinchendick. Heute ist die Ernährung anders. Leute die sich ungesund ernähren, essen nicht mehr täglich fettige Hausmannskost, sondern amerikanisches Fastfood, Fertigpizzas, Chips, zuckerreiche Süßigkeiten, Maisstärke, Convenience Food, Limonaden, etc. Der Effekt auf den Körper ist ein anderer als mit der Nachkriegshausmannskost. Heutige dicke Leute schauen anders aus, als die Dicken der Nachkriegsgeneration. Besonders deutlich sieht man den Unterschied bei den Fettleibigen Menschen in den USA. Die sind extrem schwabbelig und hauptsächlich um die Hüften extrem fett. Die schauen ganz anders aus als die Schweinsbratengesichter aus dem Dorfwirtshaus der Nachkriegszeit. --El bes (Diskussion) 21:02, 17. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:42, 20. Feb. 2014 (CET)

Vertreter für Wikimedia Foundation in Deutschland

Wer vertritt die Wikimedia Foundation in Deutschland, wenn es zu Rechtstreitigkeiten kommt? Hierfür scheint es doch anscheinend deutschsprachige Personen bzw. Juristen zu geben. Ansonsten, mit wem kann man in rechtlichen Belangen in deutscher Sprache korrespondieren, so dass es auch rechtsverbindlich ist? – Simplicius Hi… ho… Diderot! 19:18, 16. Feb. 2014 (CET)

Frag mal hier nach. --Rôtkæppchen68 19:28, 16. Feb. 2014 (CET)
Ich werde gerne dorthin schreiben, würde mich aber über eine nicht-geheime Antwort an dieser Stelle freuen. – Simplicius Hi… ho… Diderot! 20:00, 16. Feb. 2014 (CET)
Für jeden Verein sind die dafür gewählten Vorstände für rechtsverbindliche Auskünfte zuständig. Diese Antwort kann wohl kaum überraschen oder vielleicht doch?--Giftzwerg 88 (Diskussion) 22:58, 16. Feb. 2014 (CET)

Bei einem Rechtsstreit wird die Foundation, hier wohl das Legal and Community Advocacy Team, eine deutsche Rechtsanwaltskanzlei beauftragen. Vermute ich, denn IANAL ;). --тнояsтеn 10:27, 17. Feb. 2014 (CET)

Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:42, 20. Feb. 2014 (CET)

Ausnahmeregelungen für LKW-Fahrverbot in Italien

was für Ausnahmeregelungen für LKW-Verkehr am Sonntag gibt es in Italien? (z.B. Luftfrachtersatzverkehre) --217.234.170.162 19:26, 16. Feb. 2014 (CET)

http://www.truckin.de/info/fahrverbote/fahrverboteineuropateili/index.htm#ITALIEN --тнояsтеn 10:31, 17. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:43, 20. Feb. 2014 (CET)

Augenbraun länger "farbig"

Guten Abend. Mir fällt bei sehr vielen ältern Personen (besonders Herren) auf, dass Haare auf dem Kopf grau oder gar weiß sind, während Augenbrauen noch ihre ursprüngliche Farbe haben. Woran liegt das? Bleiben die Farbstoffe (ich habe keine Ahnung wie das in der Fachsprache heißt) länger erhalten? --78.52.126.60 21:54, 16. Feb. 2014 (CET)

Nicht nur Augenbrauen, auch Bart und weiter unten produzieren in unterschiedlichem Maß länger Melanin als das Haupthaar. Dass das so ist, lehrt die Erfahrung; warum, hoffentlich gleich ein Biologe. Grüße Dumbox (Diskussion) 22:39, 16. Feb. 2014 (CET)
Weiß auf Schwarz über gelb
Kann interessanter Indikator sein... GEEZER… nil nisi bene 22:49, 16. Feb. 2014 (CET)
Sorry, obwohl es eine (!) deutsche (!) Studie ist, findet man fast nur engl. Kommentare dazu. GEEZER… nil nisi bene 23:25, 16. Feb. 2014 (CET)
Bzw. nur fast englische. ;) Grüße Dumbox (Diskussion) 10:26, 17. Feb. 2014 (CET)
Hier mehr Info und eine ganze Galerie solcher Berühmtheiten. ... nur einer ist ganz einheitlich grau ... ;-) GEEZER… nil nisi bene 10:37, 17. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:43, 20. Feb. 2014 (CET)

Freie Quarks Kand. f. Dunkle Materie?

Sind freie Quarks als Dunkle Materie denkbar? Wenn zB ein swLoch mit Quark-Gluon-Plasma im Kern exlpodiert in einer Mega-Hypernova, wären die Kräfte und Geschwindigkeiten hoch genug, um eine Bindung der Quarks aneinander beim Abkühlen zu verhindern? --217.84.115.89 17:13, 15. Feb. 2014 (CET)

Ein Schwarzes Loch kann nicht explodieren. --Mauerquadrant (Diskussion) 17:37, 15. Feb. 2014 (CET)
Theoretisch unmöglich oder bisher nicht beobachtet? Von mir aus dürfen die freien Quarks auch vom Urknall übrig sein. --217.84.93.10 23:15, 15. Feb. 2014 (CET)
Um ein massebehaftetes Teilchen auf Lichtgeschwindigkeit beschleunigt werden soll brauch man unendlich viel Energie. Das Teilchen hätte dann eine unendliche Masse. Da diese Energie nicht vorhanden ist kann das Teilchen keine Fluchtgeschwindigkeit erreichen. Deshalb kann ein Schwarzes Loch nicht explodieren. --Mauerquadrant (Diskussion) 03:08, 16. Feb. 2014 (CET)
[war so frei, Deine Antwort hierhin zu schieben, da es nicht Bedingung für OP ist --217.84.93.10 03:27, 16. Feb. 2014 (CET)] Verstehe .. selbst, wenn es explodieren würde, könnte nichts entkommen. Es würde sich nur kurz in sich °aufbäumen°, aber schon im Ansatz schon wieder in sich zusammenfallen. Hätte ich wissen müssen. Danke! --217.84.93.10 03:27, 16. Feb. 2014 (CET)
Eine Bindung von Quarks aneinander lässt sich nicht verhindern, siehe Quark (Physik) und Confinement. --Rôtkæppchen68 17:57, 15. Feb. 2014 (CET)
Das Confinement ist allerdings nur eine empirisch begründete Hypothese: „Eine vollständige theoretische Beschreibung dieses experimentellen Befundes steht noch aus“. Im zweiten Satz in Experimentelle Befunde (kommen also nur eingesperrt vor) ist deshalb mindestens das Wort „also“ falsch. --BlackEyedLion (Diskussion) 21:23, 15. Feb. 2014 (CET)
QGP. [s.a. Brute_force .. ein effizienter Algoritmus ist zB das Lesen der Frage.] Und hier: [46], Astrolex., Andreas Müller: "Im Jahr 2004 wurde eine Erfolgsmeldung verbreitet: Am Teilchenbeschleuniger RHIC konnte mit den Detektoren PHENIX und STAR das Quark-Glunen-Plasma nachgewiesen werden!" --217.84.93.10 23:18, 15. Feb. 2014 (CET)

Freie Quarks würden sehr stark miteinander und mit Hadronen wechselwirken. Sie würden also keinesfalls unentdeckt bleiben. --mfb (Diskussion) 15:48, 16. Feb. 2014 (CET)

Im weiten Kosmos (interstellar) dünn verteilt, dünne °Wolken° aus freien Quarks - zu entfernt voneinander und von jedwedem anderen Material, um zu wechselwirken, doch in der Masse bei großen Räumen gravitierend .. ? --84.137.119.111 18:17, 16. Feb. 2014 (CET)
Für eine relevante Masse könnten sie nicht dünn verteilt sein. Und dann würden sie innerhalb kürzester Zeit (vermutlich Nano- bis maximal Sekunden) Hadronen bilden. Die starke Wechselwirkung ist ~40 Größenordnungen stärker als die Gravitation. Und bei Teilchen, die beide Ladungen haben (also Farbladung und Masse) sieht man eben auch beide Kräfte. --mfb (Diskussion) 23:15, 20. Feb. 2014 (CET)
"~40 Größenordnungen stärker" .. aber nur auf kurze Reichweite. Und es wirkt der Massenmittelpunkt (einer hypoth. Wolke), egal, wie dünn verteilt. --217.84.75.30 00:32, 21. Feb. 2014 (CET)
Vergiss es. Freie Quarks gibt es nicht. --Rôtkæppchen68 01:03, 21. Feb. 2014 (CET)
Es gibt sie offenbar im QGP. Du mußt schon belegen, es stichhaltig begründen, damit es eine stichhaltige Antwort ist. Nicht einfach so ablehnen. lol Man wird wohl noch gegenfragen dürfen, wenn man´s nicht verstanden hat? Also, ehrlich! --217.84.75.30 01:25, 21. Feb. 2014 (CET)

[Baustein ge-REM-t] --217.84.75.30 01:30, 21. Feb. 2014 (CET) Es gibt freie Quarks im QGP - das hab ich oben belegt. Und es gibt sie vielleicht im Inneren von Neutronensternen - das kam an anderer Stelle heraus. Es gab sie beim Urknall und da könnten fein verteilt welche °übrig° sein. Das hätt´ich gern sachllich beantwortet, so, daß die Antwort eine Gegenfrage aushält.! --217.84.75.30 01:29, 21. Feb. 2014 (CET)

Es gibt aber keine isolierten Quarks. Ein isoliertes Quark würde, wie im Abschnitt Starke Wechselwirkung#Bindung zwischen Quarks dargelegt, zu einem Meson zerstrahlen. --Rôtkæppchen68 01:37, 21. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: Frage ist längst beantwortet. Fragesteller sieht das nur nicht ein. --Rôtkæppchen68 01:03, 21. Feb. 2014 (CET)
".. zu einem Meson zerstrahlen." .. wohl in ein Quarkonium, das wiederum selbst sehr kurzlebig ist und weiter zerstrahlt und dann wohl als kosmische Strahlung keine relevante Masse mehr liefern kann. Naja irgendwie so kann ich [OP-IP-217.84.usw] es grob nachvollziehen. Jedenfalls keine stationäre Wolke aus massiven Teilchen mehr. Vielen Dank! --RoNeunzig (Diskussion) 17:20, 21. Feb. 2014 (CET)

Eine Kugel aus Nichtzeit

Ich lese gerade ein SciFi Buch (von Niven). Darin werden Raumschiffe in Bedrohungssituationen einfach in eine Kugel eingehüllt, in der die Zeit angehalten wird. Keine Zeit, keine Veränderung - also keine Beschädigung möglich. Mal vorausgesetzt das wäre möglich. Was bedeutet das für den Energieerhaltungssatz? Wenn ein Laserstrahl auf diese Kugel trifft. Würde der dann zu 100% reflektiert, würde er angehalten und nachdem die Antizeitkugel abgeschalten wird mit gleicher Energie auf das darunter liegende Objekt einwirken oder würde er "absorbiert" und damit den Energieerhaltungssatz verletzen? --78.51.227.3 17:31, 13. Feb. 2014 (CET)

Der Laserstrahl bleibt einfach an der Kugelgrenze, wo die Zeit stillsteht, auch stehen Das geht zwar nicht, aber Du hast ja gesagt, es soll gehen. (weil: "absorbieren" ist zeitlich und Energieübertragung oder ~wandlung auch und Wechselwirkung auch). Wovon soll er denn °reflektiert° werden? Von der °Zeit-aufhör-Grenzschicht°?) --217.84.69.72 18:32, 13. Feb. 2014 (CET) Larry Niven scheint sich an geltende Naturgesetze °anzulehnen° (?), doch, wenn es Dich zu realitätsnähere SF zieht, gibt es Prosa von Wissenschaftlern, die das Mögliche ausschöpft oder an den Grenzen des wissenschaftlich noch Unbekannten (also auch: Möglichen) operiert .. zB Hoyle. Oder populärwissenschaftliche Werke, Lesch, Hawking, Ditfurth & Co., die zwar nicht in Form von Geschichten mit Handlung und Hauptpersonen gefaßt sind, aber sehr kurzweilig die Faszination Wissenschaft auch auf die Realität zu beziehen verstehen oder ihre phantastischen, staunenswerten Aspekte enthüllen. Natur begreifen kann wie SciFi fesseln. --217.84.69.72 19:04, 13. Feb. 2014 (CET)
Der Laser bleibt in der Kugelhülle stecken und trifft das Raumschiff erst, wenn die Kugel wieder aufgelöst oder abgeschalten wird. Es gibt eine Startek-Folge dazu und bei Farscape und bei Stargate Universe wurde das auch thematisiert, zweite Staffel. Bei Universe leben die Insassen ein ganzes Leben in einer Zeitkapsel, bis sie als alte Leute eine Lösung für das Dilemma finden. Man hat also unter Umständen keinen Nutzen von der Verzögerung, aber man hat Zeit genug um drüber nachzudenken. 46.115.130.204 19:21, 13. Feb. 2014 (CET)
<quetsch>Wenn sie in einer °Zeitkapsel° leben, dann vergeht da Zeit und steht nicht still. Das ist was ganz anderes. Da kommt der Laser einfach durch die verschiedenen Zeitzonen, weil er masselos ist und aus seiner Sicht sowieso keine Zeit vergeht. Für einen Beobachter kommt er nur zu einer anderen (von diesem Beobachter beobachteten und gemessenen) Zeit an. Dem Laser ist es egal, ob und von wo aus er beobachtet wird. --217.84.69.72 00:29, 14. Feb. 2014 (CET) </quetsch>
Bei SG Universe ist es eine Beschleunigungskugel, d.h. im Inneren wird es schneller, so dass eine Mikrosekunde außerhalb der Kugel zu 80 Jahren innerhalb wird. Dadurch sehen die von innen den Laserstrahl ganz langsam auf sich zukommen, jedes Jahr ein paar Meter näher. Reagieren können sie nicht wegen der Trägheit des Schiffes. Offensichtlich bringt jedes Zeitparadoxon interessanten Stoff für die Science fiction. 46.115.130.204 20:03, 13. Feb. 2014 (CET)
in einem Roman von Thomas Lehr "42" ist es genau anders herum, durch einen Unfall im Cern steht die Zeit auf der ganzen Welt still, nur bei ein paar Menschen, die gerade beim Cern zu Besuch waren, geht die Zeit innerhalb einer begrenzten Blase um die jeweilige Person herum weiter, es ergeben sich dramatische Verwicklungen, die auf höchstem naturwissenchaftlichem Niveau zum Zeitbegriff und der Physik anschaulich beschrieben werden. Ich fand den Roman sehr lehrreich und spannend - StephanPsy (Diskussion) 22:05, 13. Feb. 2014 (CET)
Die Zeit steht nicht still. Die Dinge bestehen aus Molekülen & Atomen, die miteinander wechselwirken und in Bewegung sind. Wo die Zeit stillsteht ist auch absoluter Temperatur-Nullpunkt, -273,15 °Celsius. Völlig unbewegt, energielos, schwarz, kalt und tot. Entmaterialisiert. So kalt ist nichtmal die Rückseite des Mondes und der Wert wird niemals und nirgendwo erreicht. Es wäre nicht mehr existent. Außerdem: Um festzustellen, daß die Zeit °draußen° stillsteht, müssen die Besucher es ja feststellen, also Zeitpunkte vergleichen, ob sich nichts bewegt. Und zu verschiedenen Zeitpunkten messen ist ein zeitlicher Vorgang. Aber es geht auch nicht, weil die Organisation der Atome & Moleküle zu Dingen, Gebäuden, Pflanzen, Steinen, Wasser, Luft in der Zeit stattfindet .. wenn die Zeit aufhört, stoppt, zerfallen sie. Auch ein zeitlicher Vorgang. (s. Entropie) --217.84.69.72 00:57, 14. Feb. 2014 (CET)
Richtig interessant ist, wie es wirklich ist! .. Wie an der Grenze der Raumzeit, Zeit und Universum zu Existenz gelangen oder wie und wo die tatsächliche °Ausdehnung° des Universums existiert und ihre Grenzen hat, also, wie weit Raum, Zeit, Raumzeit jetzt sich in der scheinbaren Unendlichkeit auflösen zu einer in sich geschlossenen (?), jedenfalls °gekrümmten° Raumzeit - beobachtet und gemessen oder unabhängig davon. Unsere Beobachtungs-Weltlinie ist da nur ein kleiner Ausschnitt. --217.84.69.72 00:57, 14. Feb. 2014 (CET)
Wie sollte der Laser "stehenbleiben" können? Dazu müßte er die Grenze passieren, die zwischen der Feldaußenseite und dem Inneren besteht. Würde es eine Art Grenzschicht geben, in der sich die Zeit bis auf Null verlangsamt, dann hätten die Insassen wenig zu lachen, wenn das Feld abgeschaltet wird, denn dann hätte sich im Lauf der Zeit jede Menge Energie in dieser Grenzschicht verfangen - und würde beim Abschalten zugleich freigesetzt werden. Ein paar Jahre kosmischer Strahlung innerhalb weniger Sekunden erscheint mir nicht gerade erstrebenswert. Zudem müßte dann erst mal diese Übergangsschicht definiert werden. Da der Autor jedoch davon ausgeht, daß es sich um einen Schutz handelt - und der wohl nicht mehr in der Testphase zu sein scheint, sondern zur Standardausrüstung gehört, darf man davon ausgehen, daß eine solche Übergangsschicht nicht existiert. Der Sinn einer solchen Einrichtung besteht darin, daß nichts von draußen rein- und ebenso nichts von drinnen raus kommen kann. Es müßte demzufolge ein perfekter Reflektor sein. Das Problem an dieser Überlegung ist nur: wenn keine Interaktion stattfindet - wie verhält es sich dann mit der Trägheit? Aus welchem Grund sollte eine solche Blase die Bewegung des restlichen Universums mitmachen? Wie sollte man sie später jemals wiederfinden? Und wie sollte sie jemals wieder geöffnet/abgeschaltet werden können? Chiron McAnndra (Diskussion) 09:42, 16. Feb. 2014 (CET)
Wer schaltet dann nachher die °Antizeitkugel° wieder ab? (Wo doch alle in stillstehender Zeit unbeweglich eingefroren sind .. muß einer draußen bleiben und es von außen kontrollieren? ;oþ ) --RoNeunzig (Diskussion) 16:21, 17. Feb. 2014 (CET)
Bei Ijon Tichy hat das doch auch geklappt, also muss es auch im RL klappen. --Rôtkæppchen68 19:58, 19. Feb. 2014 (CET)
:o]) .. aber da ist es Fiktion - es gibt ja auch Koluppen ("Kollupse"?) nich´ in echt. --217.84.86.221 21:17, 19. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:12, 22. Feb. 2014 (CET)

My Fair Lady - Berlünerisch?

In der deutschen Übersetzung von My Fair Lady wird der Slang der Hauptdarstellerin in Berliner Dialekt übertragen - so liest man allgemein. Indessen: Das hauptsächlich Auszeichnende des Film-Dialekts ist es, ü als i auszusprechen. Aber laut Aussprachebeispielen wird in Berlin sehr wohl ü ausgesprochen (Würschte), auch wo es hochdeutsch nicht der Fall ist (nüscht). Daher die Frage: Gibt es überhaupt einen Berliner - oder anderen - deutschen Dialekt, der in etwa der Sprache im Film entspricht und ü stets als i ausspricht? Und wenn: Wie würde darin ü in Eigennamen ausgesprochen (z. B. Lübeck) - auch so? --KnightMove (Diskussion) 14:17, 14. Feb. 2014 (CET)

Bitte beachte, daß dies eine Synchronisation ist. Das Musical, bzw. Theaterstück, wurde von Robert Gilbert unter Verwendung des Berliner Dialekts ins Deutsche übertragen. Also weder ist das 1:1 Berlinerisch, noch ist der Film maßgeblich. Ansonsten gibt es sehr abweichende Ansichten über die Mundart des Berlierischen, was wohl nie eine feste Schreiblehre erfuhr, sondern immer nur ein Näherungsversuch ist. So sprechen wir "nicht" als "nich" mit -i-, aber "Nichts" als "Nüscht" mit -ü-, trotz der Wortverwandschaft. Das Wesentlichere daran ist aber das ziehen von ch zum sch, das eher das Typische ist, wie Wurscht statt Wurst, auch wenn das alles nie ausschließlich Berlinerisch war, und immer privat angepasst wurde. Bitte beachte auch, wann das Stück und der Film ins Deutsche übertragen wurde, schon damals keine "lebende Sprache" mehr, wurde Klischee mit Regelkunde und Erleben kombiniert, Gilbert war schließlich Berliner, im Gegensatz zu den meisten Schauspielern und Synchronsprechern.Oliver S.Y. (Diskussion) 14:30, 14. Feb. 2014 (CET)
In der Originalsprache spielt das wohl mit dem Gegensatz der Londoner Aussprache zur Standardaussprache des Englischen; daher liegt die Übertragung in den Gegensatz der Berliner Aussprache zur Standardaussprache des Deutschen nahe. Das „ü“ ist in mehreren mittel- und oberdeutschen Mundarten nicht präsent, stattdessen wird „i“ gesprochen; siehe Entlabialisierung und die Artikel zu den Mundarten. Auch in meiner rheinfränkischen Mundart ist das so, so dass wir auch in Eigennamen „Müller“ als „Miller“ und „Grünstadt“ als „Grienstadt“ sprechen. „Lübeck“ ist schwierig, da ungebräuchlich; ich würde es heute auch in der Mundart als eine Art standarddeutsches Fremdwort „Lübeck“ sprechen, könnte mir aber auch eine Aussprache als „Liebeck“ vorstellen. --Pp.paul.4 (Diskussion) 14:43, 14. Feb. 2014 (CET)
(BK)Ich hatte nicht angenommen, dass das realitätsgetreu war... aber ob es in dieser Hinsicht einen deutschen Dialekt gibt, würde mich trotzdem interessieren. In bairisch-österreichischen Dialekten ist das ja auch üblich, wobei sogar mehrere Laute als Ersatz für ü bereit stehen (Schissl, siaß, Bruckn). --KnightMove (Diskussion) 14:47, 14. Feb. 2014 (CET)
Mal ohne jedwede Ahnung in den Raum geworfen: "Ü" zu "I" erinnert mich an Gefilte Fisch - Jiddisch? --Eike (Diskussion) 14:44, 14. Feb. 2014 (CET)

Oder fragen wir mal so: Gibt es eine deutsche Mundart, in der Rügen standardmäßig als Riegen oder Jütland als Jitland ausgesprochen wird? --KnightMove (Diskussion) 14:47, 14. Feb. 2014 (CET)

Viele Mundartsprecher können standarddeutsches „ö“ und „ü“ sprechen und würden es für „Rügen“ und „Jütland“ auch anwenden. In Mundarten ohne gerundete Vokale und ohne engerem Kontakt mit dem Standarddeutschen wie etwa in Pennsylvanien muss dafür „e“ und „i“ gesprochen werden, da die Sprecher auch vom Englischen her die Laute „ö“ und „ü“ nicht kennen, so auch das Beispiel im schönen Artikel als:Entrundung für einen Sprecher aus Kroatien: „Ich habe meine schenen Bicher zurick lassen missen!“. --Pp.paul.4 (Diskussion) 15:12, 14. Feb. 2014 (CET)
Die bairischen Dialekte in Ober- und Niederbayern, sowie Salzburg und Tirol, haben gar keine Ö und Ü, außer in Fremdwörtern und nicht-bairischen Eigennamen. Die Wörter wie "Rügen" oder "Jütland" sind aber nicht unbedingt häufig in bairischen Dorfgesprächen. Statt Österreich sagen sie aber Estreich, statt König sagens Kini. --El bes (Diskussion) 21:32, 14. Feb. 2014 (CET)
Das Englische hat eigentlich ziemlich Ö-nahe Laute (z.B. in turtle), nur das Ü ist ihm restlos abhanden gekommen. Haben die Pennsylvania Dutch ihren Ö-Verlust evtl. schon von vornherein mitgebracht? Siehe z.B. auch pdc:Pennsilfaanisch Deitsch History. :-) --Zerolevel (Diskussion) 21:37, 14. Feb. 2014 (CET)
Ja sicher haben die Mennoniten/Amish das schon von zu Hause mitgebracht. Das Ü und Ö ist ihnen nicht in Amerika abhanden gekommen. Beim Jiddischen ist es übrigens genau so. --El bes (Diskussion) 21:41, 14. Feb. 2014 (CET)
Ich komme aus der Pfalz und da sind Ö/Ü tatsächlich unbekannt. -- Liliana 22:51, 14. Feb. 2014 (CET)
Also in „schön“ hat man ja ein geschlossenes ö, das ist schon sehr anders als dieser englische Laut. --Chricho ¹ ² ³ 23:48, 14. Feb. 2014 (CET)
Das Berliner ü (Det macht nüscht, ick bün ja nich so.) ist ursprünglich eine typische Hyperkorrektur, die sich erst seit dem Zweiten Weltkrieg durchgesetzt: vorher sprach der Berliner typischerweise alle standarddeutschen /ü/ ungerundet, also wie /i/ aus, heute viele /i/ gerundet wie /ü/ (in Nachbarschaft von Liquiden?). Zum Beispiel in Berlin Alexanderplatz oder in den Unterschriften von Karikaturen von Heinrich Zille findet man die Entrundung des /ü/ noch als typisches Merkmal des Berlinischen. Diesen Lautstand greift der Film My Fair Lady in der reichsdeutschen Synchronisation auf. Siehe auch (nur als Beispiel, es gibt viel mehr an Literatur): [47]. --Hermine Tuzzi (Diskussion) 23:32, 14. Feb. 2014 (CET) Übrigens, wußten Sie schon? Die Fünf hieß im Althochdeutschen noch durchgängig fimf. --Hermine Tuzzi (Diskussion) 23:36, 14. Feb. 2014 (CET)
Danke für die Literatur! Das entscheidende Stichwort ist Entlabialisierung (=Entrundung), da sind auch entsprechende Dialekte in Auswahl aufgeführt. Nach Berlin kam's also über das Obersächsische, das ebenfalls durch Entrundung gekennzeichnet ist. Damit ist's für mich ausreichend beantwortet.--Sbaitz (Diskussion) 21:59, 17. Feb. 2014 (CET)
Vielleicht Schlesisch, oder Luxemburgisch („Jingelchen“ für Jünglein).--kopiersperre (Diskussion) 23:47, 14. Feb. 2014 (CET)
An Schlesisch hatte ich auch gedacht: Im Niederschlesischen macht man "viel Miehe" (statt "Mühe"), das Jüngelchen wird zum "Jingla", Prillkoasta = Radio (Brüllkasten), Oberriebe = Oberrübe, varrickt = verrückt und (vom Grossvater) "Mein Gott, bin ich miede, nur beim Schloffa, da gehts..." - Aber ich will nicht nahelegen, dass das aufs Musikal zutrifft (dennoch, in Berlin gab es grosse Schlesierbrutkolonien). GEEZER… nil nisi bene 09:50, 15. Feb. 2014 (CET)

Doch noch eine Frage hierzu: Könnte es sein, dass in der "Übersetzung" von

„The rain in Spain stays mainly in the plain.“,
„Es grünt so grün, wenn Spaniens Blüten blühen.“

deshalb Spanien sinnwidrig dringeblieben ist, weil eine geographische Bezeichnung mit ü nach dem Gefühl von Robert Gilbert eben doch nicht mit i auszusprechen, und daher eine Verschlimmbesserung gewesen wäre? --KnightMove (Diskussion) 23:31, 19. Feb. 2014 (CET)

Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:12, 22. Feb. 2014 (CET)

Norm für Bücherregale

Meine wachsende Büchersammlung verlangt den Bau eines neuen Regals. Frage: Gibt es da eine Norm für die Höhe eines Regalfachs? Google findet auf die schnelle nichts...--Antemister (Diskussion) 12:36, 15. Feb. 2014 (CET)

Ehe wir in Details gehen: Kennst du die Regale, bei denen man die Höhe durch Einstecken von Stiften anpassen kann? Hier mit "Lupe" sichtbar. GEEZER… nil nisi bene 12:40, 15. Feb. 2014 (CET)
Da es auch keine Norm für Büchergrößen gibt... aus der Praxis rate ich, auch ein hohes Fach für die Kataloge und Bildbände vorzusehen. --87.167.242.85 12:47, 15. Feb. 2014 (CET)
(BK) Das Problem bei Büchern ist, dass sie sich nicht an Normen halten. Von Klein-Oktav (Reclam-Büchlein) bis zur Atlantengröße (Zettels Traum) oder Querformat ist alles dabei. Schau halt nach, wie groß Deine Bücher sind. Ansonsten, wie Kollege Grey Geezer andeutet, den Brettabstand variabel gestalten. Ein Tipp: Die größten Bücher kommen nach oben, dann ist das oberste Brett nicht ganz so hoch und man kommt besser dran. --Zerolevel (Diskussion) 12:52, 15. Feb. 2014 (CET)
(quetsch) eigentlich kommen die größten Bücher nach unten, damit man sich nicht so tief bücken muss. --79.207.40.1 17:09, 15. Feb. 2014 (CET)
Ja, wenn es keine Norm gibt, dann habe gedacht einen Leitz-Ordner als Maß zu verwenden. Größer sind Bücher selten.--Antemister (Diskussion) 13:05, 15. Feb. 2014 (CET)
Das sieht bei Taschenbüchern doof aus, find ich. Ich nehm auch Geezers Lösung, und die Regale sind dann je nach Inhalt unterschiedlich hoch. --Eike (Diskussion) 13:08, 15. Feb. 2014 (CET)
eine Norm bei einem Bücherkasten ist - wie schon erwähnt - eine genormte Ordner-größe. Wie zB. ein Bene-Order. bei diversen Büchern über Kunst - in welchen auch HochglanzAbbildungen sind - kann es zu Übergrößen kommen, hierbei empfiehlt es sich im unteren Bereich größere Abmessungen vorzunehmen. --80.108.60.158 13:38, 15. Feb. 2014 (CET)
eventuell sollte man noch das Gewicht beachten. Wenn man bei den Bretterböden zu dünn wird, dann kann sich das durchbiegen. Dabei kommt es auf die Konstruktion an, wie man dem entgegnet. Dafür gibt es mehrere Lösungen. (und auch darauf achten, dass die maximale Bodennutzlast ...... unbedingt bei tragenden Hauselementen .....) --80.108.60.158 13:49, 15. Feb. 2014 (CET)
sollten verstellbare Regale mit Stiften ..... dann empfiehlt sich hierzu eine "Lehre (Technik)" für eine Bohrerführung. Einen so dimensionierten Streifen, aus Hartholz, dass er mir auf den Seiten der benötigten Löchern als Lochbohrführung dient. --80.108.60.158 14:07, 15. Feb. 2014 (CET)
Wenn Du Spanplatten verwendest, nimm Minimum 21mm, besser 24mm, dann biegen sich diese auch nach Jahren nicht durch (oder kaum sichtbar). "Normale" Bücher sind heutzutage sehr oft in A5 + Buchdeckel, also etwa 21cm bis 22cm hoch. --Asurnipal (Diskussion) 18:16, 15. Feb. 2014 (CET)
Willst Du wirklich ein Bücherregal selbst bauen? Ich denke, wenn Du Dir so einen von Geezer verlinkten Bausatz kaufst, sparst Du eine Menge Geld, Zeit und Nerven. -- Gerd (Diskussion) 19:06, 15. Feb. 2014 (CET)
Wird nichts besonderes, zwei oder drei Bretter, je zwei Meter lang, mit Winkeln an die Wand montiert. Also das bekomm ich schon hin. Auf verstellbares will ich ja verzichten.--Antemister (Diskussion) 23:28, 15. Feb. 2014 (CET)
Bücherregale orientieren sich an dem Buchformat. Ich würde Regalhöhen von 26,5 cm bauen, das bedient ganz gut alle Formate bis 4° (Quart). Je nach Materialbestand außerdem dann ein oder zwei Regalkästen für Folio, am besten in Ordnerhöhe, also Minimum 34 cm. (Und selbstverständlich im unteren Bereich, das hat sich so u.a. durch den optischen Eindruck ergeben, den ein Bücherregal in einem Zimmer macht.) Unter normalen Umständen hat man die Mehzahl der Bücher in kleineren Formaten. Stellt man diese mit Büchern mit den größeren Formaten zusammen, ensteht in dem Regal jede Menge ungenutzter Raum. Wenn es sich einrichten läßt sollte man also die größeren von den kleineren Formaten getrennt stellen. Dieses Vorgehen setzt aber auch eine bestimmte Erwartung an die Wirkung des Regals im Zimmer voraus. Wenn man es sich leisten kann und entsprechend wohnt, strahlt ein Regal mit viel ungenutztem Raum vielleicht etwas anderes aus als die Massivität des Regals bei optimal genutztem Raum. Bildbeispiele Bild 1: Beispiel für optimal genutzten Raum und Bild 2: Beispiel für viel ungenutzten Raum und Bild 3: Beispiel für viel ungenutzten Raum, weil die Option, die Höhe anzupassen nicht genutzt wird. --84.191.178.97 03:47, 16. Feb. 2014 (CET) Nachsatz: Bei einer Regallänge von mehr als 1 m kann das Regalbrett sich je nach Material und Belastung stark durchbiegen. 2 m ohne weitere Stützen sind imho zu lang, um ein Brett nur an seinen Enden zu befestigen. --84.191.178.97 03:53, 16. Feb. 2014 (CET)
witzig. idR ist ein Kastenelement 80 bzw 60 cm. es gibt auch 40er. Beim Ikea könnte man sich einfach solche Element besorgen. ODER mit den Maßen zum Schreiner und abgelängte Bretter bestellen. vlt mag man dann auch noch eine Lichtleiste einbauen? Und wenn man dann Belletristik usw alphabetisch geordnet haben will, empfiehlt sich eine komplett durchgezogene Einheitsgröße der Fachhöhe. (hab einen Gesellenbrief für Holz ihr Freaks) --80.108.60.158 05:27, 16. Feb. 2014 (CET)
da Antemister die stehenden Häupter (=Fachbegriff) an die Wand montieren will, erkenne ich sowieso etwas Ahnung von der Materie. am einfachsten einen Rohentwurf vom Papier an die Wand übertragen und die Steher montieren. Und die Fächer hinein. fertich. --80.108.60.158 05:47, 16. Feb. 2014 (CET)
vlt noch.... es gibt doch auch so Kartons zum verstauen. eventuell so etwas einberechnen. Das man so einen Karton in so ein Fach verstauen kann. --80.108.60.158 05:54, 16. Feb. 2014 (CET)
Zu: "idR ist ein Kastenelement 80 bzw 60 cm" - ok, bei Pressspan muß das auch sein. Aber bei Fichte mit 20 mm Stärke kommt ein 1 m-Brett mit Büchern bis 4° ganz gut klar. --84.191.178.97 12:06, 16. Feb. 2014 (CET)
Encyclopædia Britannica, mit dem einen Band der Propedia (grün), der Micropedia (rot) und der Macropedia. Dazu kommt am Ende der zweibändige Index (blau).
<revers zu dem vorhergehendem Eintrag: ok, bei Pressspan ...> natürlich kommt es auf die Spannung des Materials dabei an. ab und zu reicht schon eine minimale Verstärkung - eventuell an der Front, durch eine Stabilitätstechnische Begebenheit - mit einer Zierleiste (oder auch ohne Zier). Ich könnte mir auch eine diesbezüglich geeignete Testreihe bei den Mythbusters vorstellen. --80.108.60.158 12:28, 16. Feb. 2014 (CET)
 :-) Dann aber als Maßeinheit mit einem der 32 Bände der Encyclopædia Britannica... --84.191.178.97 15:11, 16. Feb. 2014 (CET)
Noch ein Tip: Beachte die Bessel-Punkte! --Hermine Tuzzi (Diskussion) 13:18, 16. Feb. 2014 (CET)
Keine Angst, das Ding wird schon stabil genug werden (ca. fünf Winkel...) Für großformatige Werke habe ich genug Platz, deshalb erschienen mit das Leitz-Ordner-Format als zu groß, daneben habe ich ein Regal mit 22 cm, da geht das meiste rein, viele Hardcover ganz knapp, einige wenige aber gerade nicht mehr, und das ärgert einen wenn man thematisch aufstellen will. Die 26,5 cm erscheinen da sinnvoll.--Antemister (Diskussion) 21:53, 16. Feb. 2014 (CET)
Ich habe bei den Bezeichnungen versehentlich auf die Schnelle das historische Quart 4° mit dem heute gebräuchlichen Groß-Oktav (gr. 8°, bis 25 cm) verwechselt. Entschuldige bitte. An den cm-Angaben ändert sich nichts. Über der Oberkante des Buchdeckels sollte ohnehin immer ein kleines bißchen Platz sein (wg. Buch greifen können, Staubsauger reinhalten oder durchhängende Bretter etc.). --84.191.137.225 03:05, 18. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 04:08, 21. Feb. 2014 (CET)

Standardschriftart und Zeilenabstand in Word festlegen

Guten Tag, ich habe ein Problem: Und zwar schaffe ich es nicht, die Standardschriftart und den Zeilenabstand in Word (Office 2010) dauerhaft zu ändern. Natürlich habe ich gegoogelt, und alle die dort erscheinenden Hinweise, z.B. das hier, kannte ich schon und hatte es ausprobiert. Nur: Jedes Mal, wenn ich wieder ein neues Dokument öffne, sind wieder die alten Einstellungen da... Ich weiss, dass ich dieses Problem schon mal hatte und es damals lösen konnte, aber ich weiss nicht mehr wie (in meiner Erinnerung hatte es etwas mit den "Designs" unter "Seitenlayout" zu tun, aber sicher bin ich mir nicht mehr). Über Hilfe wäre ich sehr froh. Danke und herzliche Grüsse, --Marca2011 (Diskussion) 14:50, 16. Feb. 2014 (CET)

Öffne die Standardvorlage normal.dotm und ändere sämtliche Standardformatierungen dort. Du findest die Datei unter %appdata%\Microsoft\Templates\Normal.dotm. --Rôtkæppchen68 15:06, 16. Feb. 2014 (CET)
Ha, Rotkaeppchen, Du weisst schon, dass Du grossartig bist, oder? Das ging ja so einfach, ich glaub es fast nicht. Und ich hab mich tagelang damit abgemüht, bei jedem neuen Dokument alles neu einzustellen - und das waren Duzende Dokumente. Danke, danke, danke. --Marca2011 (Diskussion) 15:20, 16. Feb. 2014 (CET)
Das machen die über 20 Jahre Erfahrung mit Microsoft Word for Windows ab Version 1.1 (1990). --Rôtkæppchen68 16:17, 16. Feb. 2014 (CET)
Ich würde eher sagen, gewisse grundlegende Einsichten in die Funktionsweise einer Textverarbeitung (nicht nur Word). Leider ist für geschätzte 99% aller Nutzer der Begriff „Formatvorlage“ immer noch ein komplettes Fremdwort. --Jossi (Diskussion) 12:10, 18. Feb. 2014 (CET)
... und dann kommen sie mit 3, 10 oder 50 Seiten voller handgemachter Überschriften zu dir und fragen: "Und wie mach ich da jetzt das Inhaltsverzeichnis?" *seufz* --Eike (Diskussion) 12:14, 18. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 04:11, 21. Feb. 2014 (CET)

Intergalaktische Objekte?

Was fliegt so alles `rum im intergalaktischen Raum, in voids auch?
Interstellarer_Raum und Intergalaktisches Medium liefern da keine Antwort. Könnte mir vorstellen, aus der Bahn geratene Planeten; Monde; ausgebrannte Sonnen (?) / Neutronensterne (?); .. ? Gibt es Objekte nichtgalaktischen Ursprungs? --84.137.119.111 18:54, 16. Feb. 2014 (CET) Ach noch .. und werden Verdunkelungen durch intergalaktische Objekte beobachtet? --84.137.119.111 18:57, 16. Feb. 2014 (CET)

Aus dem hohlen Bauch argumentiert: Aus der Bahn (um ursprünglich ein glaktisches Zentralgestirn) geratene Planeten und Monde können es praktisch nicht aus dem Schwerefeld ihrer Galaxie schaffen (in nennenswertem Umfang allenfalls vielleicht im Rahmen einer Galxienkollision). Ausgebrannte Sonnen bleiben auch da, wo sie zu Lebzeiten waren. Größere Einzelobjekte könnten sich zwar aggregieren, aber wenn eine örtliche Gasdichtenschwankung für einen Stern reicht, dann normalerweise gleich für ein paar Größenordnungen mehr, also eine eigene kleine Galxie; wenn es denn ein einzelnes Objekt sein soll, dann vielleicht ein schwarzes Loch? Im wesentlichen ist zwischen den Galaxien also eher wenig los an Objekten die sich deutlich vom intergalaktischen Gas absetzen. Verdunkelungen durch intergalaktische Objekte sind dann so eine Sache: Was die verdunkeln könnten wären allenfalls ganze Galaxien und als Einzelobjekte müssten die die dann zwecks Verdunkelung schon dermaßen nah an uns 8statt der anderen Galaxie sein) ... Am ehesten denkbar wären intergalaktische Objekte ansonsten an den Stellen höchster Dichte, also den Filamenten - aber dann wohl auch am ehesten wiederum im Einzugsbereich der einzelnen Galaxien. --Hagman (Diskussion) 23:58, 16. Feb. 2014 (CET)
siehe bitte auch A new class of extragalactic objects & Extragalaktische Astronomie und free-floaters.--Asteroidenbergbauer (Diskussion) 14:26, 17. Feb. 2014 (CET)
= en: rogue planet = Einige Beispiele verwaister interstellarer planetenähnlicher Objekte, die ohne einem Sonnensystem anzugehören die Galaxie direkt umkreisen. Möglicherweise Vorstufen brauner Zwerge ("en:sub_brown_dwarfs"). Man weiß nicht, ob sie aus einem Sonnensystem hinauskatapultiert wurden oder fern der Sterne sich unabhängig formten. --RoNeunzig (Diskussion) 17:00, 17. Feb. 2014 (CET)
en:Intergalactic_star (=en: rogue star). Eine Ansammlung roter Riesen im Virgo-Haufen bei Galaxie M87; entfernt genug von dieser, um von der Gravitation des Virgo-Haufens stärker gelenkt zu sein, als von M87. Vermutlich bei der Entstehung des Haufens aus dem Einzugsbereich ihrer gebärenden Galaxie hinausbefördert. --RoNeunzig (Diskussion) 16:33, 17. Feb. 2014 (CET)
Objekt planetarer Masse und auf der ESO Seite und hier. --84.152.5.36 21:39, 17. Feb. 2014 (CET)
Zitiere sinngem.: "Freifliegende Planetare könnten die Zahl der Sterne überwiegen." - Das ist viel! --217.84.95.167 15:52, 18. Feb. 2014 (CET)
Ab und an scheinen wohl doch einzelne Sterne aus der Galaxie zu fliegen: http://www.iflscience.com/space/%E2%80%9Chypervelocity-stars%E2%80%9D-escaping-milky-way-could-represent-entirely-new-class --StYxXx 22:39, 19. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:13, 22. Feb. 2014 (CET)

Schönheitsreparaturen

Angenommen, jemand übernimmt eine Mietwohnung in schlechtem Zustand (teilweise fehlende Farbe an Wänden, Fußleisten defekt, Tapete teilweise defekt). Diese Mängel werden im Übergabeprotokoll festgehalten. Im Mietvertrag findet sich aber eine typische Klausel zu Schönheitsreparaturen inkl. üblicher Fristen und auch ausdrücklich der Hinweis, dass bei Auszug Kosten für eine länger zurückliegende Renovierung anteilig getragen werden müssen. Kann man sich dabei auf den Zustand der Wohnung bei Übergabe berufen? Ist man durch eine solche Klausel verpflichtet, die Wohnung in einem deutlich besseren Zustand zu übergeben als bei der Übernahme? --Drones08 (Diskussion) 19:46, 16. Feb. 2014 (CET)

Rechtshinweis Bitte den Hinweis zu Rechtsthemen beachten!
Wenn die Wohnung unrenoviert übernommen wurde, darf sie unrenoviert zurückgegeben werden und umgekehrt. Da hat es ein paar BGH-Urteile zu gegeben. --Rôtkæppchen68 22:06, 16. Feb. 2014 (CET)
Ich finde diese Urteile nicht. Ich weiß auch nicht genau, wo nach ich da Googlen muss. Hast du eventuell einen Link? --Drones08 (Diskussion) 22:20, 16. Feb. 2014 (CET)
--84.191.137.225 02:43, 18. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 04:11, 21. Feb. 2014 (CET)

Question in English

Sorry my German is not good. My english is not great too because I come from Norway.. But someone asked me to ask my question on English language:


What did Hiltler think of England and the English. Did he think they are Aryan/Germanic brothers? --Weltenlängstezusammengesetzteswort (Diskussion) 20:07, 16. Feb. 2014 (CET)

yes, he considered the English in their fundaments as germanic brothers, but he thought, they are governed by an evil selfish aristocracy, that sees Germany as a competitor in their global monopolistic trade empire. The result was, that he frequently changed from being slightly anglophile to openly hating the evil Albion. One interesting effect of this attitude was, that British prisoners o war (and Americans) were certainly treated the best in German POW camps, compared to other nationalities. --El bes (Diskussion) 21:20, 16. Feb. 2014 (CET)
You might be interested in the relationship between Houston Stewart Chamberlain and (German) Nazism. --Chricho ¹ ² ³ 01:51, 18. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 04:12, 21. Feb. 2014 (CET)

Seltsame kleine Figur

Ein abgelaufenes Ebayangebot: http://www.ebay.de/itm/261377516450 Aus welchem Erdteil, Kulturkreis und welcher Epoche stammt denn wohl dieser freundliche kleine Herr? Solche Votivgesten (Hände angewinkelt vor Brust/Bauch mit Gefäß o.ä.) sind bei religiösen Idolen ja scheinbar international verbreitet gewesen. Ist das eine Art Turban auf seinem Kopf, was orientalisches? Was könnte da sonst Anhaltspunkte liefern? Wie recherchiert man sowas?

--87.167.249.71 21:17, 16. Feb. 2014 (CET)

sieht vom Stil her nach einem Imitat amerikanischer vorkolumbianischer Hochkulturen aus, ev. auch Osterinseln. --El bes (Diskussion) 21:23, 16. Feb. 2014 (CET)
An sowas dachte ich - neben Afrika - zunächst auch, wohl ein Souvenir von dort, aber dann habe ich mir mal per Bildersuche viele viele Idole aus den ganzen Gegenden angeschaut, auch Südsee etc, und die sind fast alle abstrakter und schematisierter, auch die Proportionen Kopf - Körper sind meistens anders, ich habe eigentlich nichts vergleichbares gefunden, obwohl schon viel mit der Körperhaltung. Vergleichbar von den Proportionen und Körperhaltung waren eher paar alte europäische (heidnische) und ältere (präislamische) orientalische. Aber da waren dann oft die Köpfe wieder anders. Das Ding sieht ja schon fast aus wie der Archetyp von "Götzenbild". Vielleicht was frei erfundenes, bzw. nachempfundenes? Oder Imitat von xy (dann wohl eher Anfang 20. Jhrd.) könnte auch hinkommen, Messing (oder auch Kupfer in solchen Farbtönen) gibt es aber natürlich auch schon etwas länger als Werkstoff, das hatten schon die Römer (römisch sieht es nun wirklich kein bisschen aus) und Perser. Dann könnte man nach den Bearbeitungsspuren schauen: Moderne Werkzeuge? Guss, handgefertigt (gegossen/geschmiedet)? Die dunkle Patina wirkt nicht künstlich und ist überall dort noch stark, wo sie sich (beim Tragen? Anfassen?) nicht abgerieben hat, weil sie nicht exponiert war. Und in meinen Augen ist der Götze nackt, aber trägt eine Kopfbedeckung. --87.167.249.71 21:45, 16. Feb. 2014 (CET)
Die ähnlichsten bis jetzt - mund, Hände, dargestellte Männlichkeit - finde ich mit GoogleImages => statues Colombia <= GEEZER… nil nisi bene 23:49, 16. Feb. 2014 (CET)
Und den Bauchnabel, nicht zu vergessen. Bei der winzigen Größe ist wohl alles explizit dargestellte irgendwie signifikant. Die (prä)kolumbianischen haben aber doch auch eher diese riesigen Köpfe und kleinen Körper, also andere Proportionen, und die Augen...? Ich komm auch nicht weiter. Oberflächlich betrachtet könnte es ja zb. auch das hier dargestellte Idol sein: http://www.ebay.de/itm/Marquesas-Inseln-Islands-Idol-Indigene-Moda-Mode-fashion-Stich-engraving-1875-/360840222200 Kappe, Beine, Haltung, Proportionen passen ungefähr, Gesicht naja, das "Gefäß" fehlt halt. Aber ich habe die Befürchtung, dass es in allen möglichen Kulturkreisen mit solchen ähnlichen Idolen immer wieder mal was "so ähnliches" gibt, ohne dass es das aber wirklich ist. Leider mangelt es ihm an Besonderheiten, die gute Suchbegriffe hergeben würden. Die Kopfbedeckung, seine "Frisur"... Proportionen... der komische Buckel (?) vielleicht, ansonsten ein "Allerweltsgott", "das Übliche", quasi. --87.167.227.112 00:31, 17. Feb. 2014 (CET)

Und ich denke halt, wenn es ein Souvenir ist, also für Touristen, als Schmuck hergestellt, müsste es ja 20. Jahrhundert, und da eher die zweite Häfte sein (Massentourismus, touristische Erschließung der Länder). Es wirkt aber schon noch älter (allein die Patina), wie viel älter ist aber unklar. Aber wer sollte vor der Zeit des Tourismus (Beginn ca. Mitte/Ende 19. Jahrhundert, die wohlhabenden Engländer zuerst) so etwas, und für wen, herstellen, und warum, wenn nicht aus religiösen/kultischen Gründen, die mit der dargestellten Figur verbunden sind. Wer soll sowas sonst kaufen: die Figur wirkt eher düster und bedrohlich als niedlich und schmückend und "heidnisch", da kauft man sich doch eher was hübsches oder gottgefälliges. Oder? --87.167.227.112 00:56, 17. Feb. 2014 (CET)

Mich erinnert es auf Anhieb in Schlichtheit und Machart und Kompaktheit an Däniken´s außerirdische Flugobjekt-Kleinodien. (Aztekisch? Maya? Inka? sowas) Soll wohl der passende Astronaut (Fake dann wohl?) dazu sein. Nicht gefaked käme ein Eroberer in Rüstung in Frage (?). Wie recherchiert man es? .. Würde (außer wiki) mit dem link ein Antiquitäten oder Kunstfälschungs-Forum anposten zB.? Oder gar auf Verdacht einfach mal "kleiner Messing Astronaut" +- Däniken Flugobjekt Inka-Raumschiff usw, um einen gängigen Touristen-Bauernfänger schonmal auszuschließen. --RoNeunzig (Diskussion) 00:03, 18. Feb. 2014 (CET)
Auch dafür wirkt es zu alt (wie lange dauert es, bis Messing so eine fast schwarze Patina bildet?) - und das Wesen ist ja nackt, und nicht mit Raumanzug bekleidet. Und so einen Däniken-Nepp-Anhänger (schöne Idee) würde man doch wohl um der Rendite willen industriell in einem Gussverfahren herstellen lassen, das ist aber offensichtlich ein handgefertigtes Einzelstück mit entspr. Unregelmäßigkeiten, sehr fein und aufwändig gearbeitet. Ebay ist ja voll von diversen Engeln, Buddhas, Shivas etc, die industriell gefertigt sind - sieht ganz anders aus. Ich tippe also auf ein Herstellungsdatum vor Däniken, vor 20. Jhrd., Massentourismus und Industrie. Erst dachte ich, Messing gibt es ja noch nicht so lange, aber dann wurde ich hier eines besseren belehrt. Womit man wieder bei der Frage wäre, wann und in welcher Kultur und zu welchem Zweck jemand so etwas fertigen (oder kaufen) würde - es gab ja durchaus Länder und Zeiten, wo man womöglich sogar ziemlichen Ärger bekommen hätte, wenn so etwas bei einem entdeckt wurde. Also: etwas hübscherer Touristenkitsch - eher unwahrscheinlich, wenngleich natürlich immer noch möglich. Oder kein Souvenir - aber was dann und von wann? Südamerika? Afrika? Nicht notwendigerweise, die Stilistik und unser voreingenommener Blick können täuschen, und die Geste ist sehr alt und universell:

http://tierdoku.com/index.php?title=Bild:Totenmaske-von-Agamemnon-1414.jpg

http://www.die-neue-sammlung.de/z/weiden/presse/public/press_07/keramik_vom/ftp/02_idolgefaess.jpg

http://blog.snafu.de/managerex/files/2009/02/votive-figs41.jpg

http://www.gaiaauction.com/upload/fichiers/19522103224bf2767d0d1fa.JPG

etc. (und nur das letzte ist hier südamerikanisch). Müsste wohl doch ein Experte mal ran. --84.130.212.198 12:20, 18. Feb. 2014 (CET)

Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 04:13, 21. Feb. 2014 (CET)

Tierfutter

Hallo! Es gibt ja in der Löschprüfung seit einiger Zeit eine Diskussion über Lebensmittelabfall und -verschwendung. In dem Zusammenhang fällt auch die Verwendung von Nahrungsmitteln, die eigentlich für die menschliche Ernährung geeignet sind (und historisch auch verwendet wurden) als Tierfutter. Kennt jemand eine Übersicht, wo man die Nährwerte von Ziegenohr, Pferdesehne, Angusschlund und Rinderhuf nachlesen kann? Oder wahrscheinlich bekannter, Schweineohr, Ochsenziemer und Rinderkopfhaut.Oliver S.Y. (Diskussion) 14:28, 13. Feb. 2014 (CET)

Nach 20 Min. Suche (in Deutsch): praktisch nichts zu konkreten Körperteilen gefunden (Englisch habe ich mal weggelassen). Man könnte aber pragmatisch vorgehen, indem man sich die Brennwerte von Kollagen (Knorpel, Ohrwaschel, Schlund, Sehne, Haut) heraussucht.
Ochsenaugen (Brennwert in kcal) und Schweineohren (Brennwert in kcal) GEEZER… nil nisi bene 16:12, 13. Feb. 2014 (CET)
Und wie ist das mit Buchfinkenhirnen, Otternase, gerösteten Jaguarohrläppchen und Wofszitzenschips? --Die populäre Front
…Känguruhoden, Buschschweinanus. --Rôtkæppchen68 18:07, 13. Feb. 2014 (CET)
Bist du sicher, dass es bei dem Zeugs um's Essen ging, Oliver? Ich kann dir zu einem Teil der oben genannten Einzelteile die "klassische" Verwendung nennen. Die wenigsten davon wurden gegessen. Yotwen (Diskussion) 21:40, 13. Feb. 2014 (CET)
Also was ich so über alte Sitten las, da wurden viele Teile solange gekocht, bis es weich war. Gebratene Knorpel wie Ohren und Schwänze schnurppst auch heute mancher gern beim Spanferkelessen. Die Hufe hab ich nur als Beispiel erwähnt. Was den Schlund angeht, so gehört der bei mancher Zerlegung zum Kopf, und wurde zu Sachen wie Sülze verarbeitet, oder lag beim Schlachtfest daneben. Vor allem eignen sich aber sehr viele von diesen Teilen zum Kochen von Brühen und Suppen, wo zumindest der Fettanteil als Nahrung ausgekocht wurde. Und auch wenn Sehnen nicht geniessbar sind, beim Schlachten bekommt man die ja nie ganz sauber hin, sodaß auch dort Fleisch anhaftet, was man ablösen oder abknabbern kann.Oliver S.Y. (Diskussion) 22:55, 13. Feb. 2014 (CET)
PS - Um das nochmal etwas Offtoppic zu erläutern, ich lehne Artikelchen wie den Genannten nicht ab, weil dort "grüne" Ziele verbreitet werden, sondern weil da eine Realität ausgeblendet wird. Wenn früher von einem Rind 75% verwendet wurde, und heute knapp die Hälfte, kann man diese Differenz als Verschwendung betrachten. Wenn man sich anschaut, was für Teile das in welchen Mengen sind, muß man sich meines Erachtens einfach Fragen, wer wirklich wöchentlich Rinderleber/-magen/-nieren/-lunge essen will. Und da man nunmal bei Rindfleisch einen maximalen Fettanteil gesetzlich definiert hat, und niemand solches Schmalzfleisch mehr mag, wird eben häufig viel Mischgewebe mit Talg und Sehnen nicht beim Fleischer angeboten. Sehe 5 Minuten kuttern oder mit ner 1mm Scheibe wolfen, und die meisten von uns würden das im Burger nicht merken, wenn 5% des Fleischs daraus besteht, und nicht nur 2%. 3% - plump gesagt, werden dann 2 Rinder je 100 Tiere weniger geschlachtet, oder 650.000 Tiere im Jahr bei der aktuellen Weltproduktion, ohne das jemand auf die Menge/Gewicht seiner Nahrung verzichten muss.Oliver S.Y. (Diskussion) 23:04, 13. Feb. 2014 (CET)

So eine schöne, lange Frage verdient eine ebenso schöne, lange Antwort, Oliver ;). Ihr müsst euch selbst auf

  • Schweineohren, -schwänze und Füsse wurden wie früher ordentlich rasiert, mit den Köpfen und Schwarten, Speck, Vearbeitungszungen usw. gepökelt und mit dem Fleisch für die Kochwurst gebrüht. Damit war ein Teil der Gelatine für die Blut- und Leberwurstherstellung kräftiger. Man hatte mehr Kesselbrühe. Am gleichen Tag verkaufte man die gebrühten Teile. Es gab entsprechend schwer arbeitende Leute, die die Kalorien (sehr fett) vertragen konnten. Die Kesselbrühe wurde übrigens mit Schrot und den "Kesselplatzern" (gebrochene Wursthüllen) gemischt und gegart. Das war das geringwertigste Kochwurstprodukt und ein Arme-Leute-Essen.
  • vom Schlund wurde vor der Erfindung der Kunstdärme die Muskelhülle abgezogen und der verbleibende Schlund als Wursthülle verwendet. Die Muskelhülle wurde in der Kochwurst verarbeitet. Heute brüht noch mancher Metzger den Schlund im Ganzen mit und zieht die Bindegewebsteile im gekochten Zustand ab.
  • Hufe von Paarhufern (Rinder, Ziegen...) wurden separat gesammelt und an spezielle Anbieter verkauft, die daraus Klauenöl herstellten. Das ist ein feinmechanisches Öl, dass früher gerne für Näh- oder Schreibmaschinen verwendet wurde.
  • Die Hörner wurden an den gleichen Käufer verkauft. Mit dem Hornrest der Füsse wurde das Horn geraspelt und als stickstoffhaltiger Dünger, beispielsweise für Kakteen verkauft (Hornspäne).
  • Der Ochsenziemer ist der Penis eines Bullen, der zwischen zwei Knebeln aufgedrillt und gestreckt getrocknet wurde. Das ist fast nur Bindegewebe, ungefähr so zäh wie eine Pferdesehne und war nie als Lebensmittel gedacht. Darüber hinaus gehören die Geschlechtsteile (wie auch Augen, Ohrausschnitte, Nabel usw.) in Deutschland zu den Konfiskaten und dürften den Schlachthof nur in Richtung einer Tierkörperverwertungsanstalt verlassen. In anderen Ländern ist man da weniger zimperlich und isst bis heute so ein Zeug.
  • Rinderköpfe werden auch heute noch ausgelöst. Die Zunge gilt, gepökelt und gekocht, bei manchen Leuten als Delikatesse. Die Lefzen werden gewässert und das Wasser mehrfach gewechselt, um den Schleim herauszuziehen. Gepökelt und gekocht bilden sie die Grundlage für den Ochsenmaulsalat. Das restliche Kopffleisch wird als Verarbeitungsfleisch verwendet. Das Hirn wurde früher aus dem Schädel genommen und separat verkauft, meist mit Zwiebel gebraten und mit Salz und Pfeffer gewürzt gegesen. Seit der bovinen spongiformen Enzeophalitis ist das nicht mehr.
  • Rinderkopfhaut wurde wie die andere Haut des Rindes abgezogen. Rinderhäute sind auch heute noch die Grundlage für Industrieleder. Aus Hautresten wurde früher Gelatine gewonnen. Noch so ein Opfer der BSE-Katastrophe.
  • Schweinemagen wurde früher als Wursthülle verwendet (z.B. Pfälzer Saumagen)
  • Von den Därmen wurde früher viel mehr verwendet, siehe Wursthülle. Teilweise wurde sogar der Darm noch einmal in Innen- und Aussenhülle gespaltet um die Ausbeute an Wursthüllen zu vergrössern (unbezahlbar). Aus Frankreich kenne ich die Verwendung, bei der Därme übereinander auf einen Stock gezogen wurden. Dann wurde der Stock herausgezogen und die "Wurst" geräuchert (schmeckt so, wie es riecht). Diese Lösung beruht vermutlich nur darauf, dass Wurst in Frankreich nicht den gleichen Ruf geniesst, wie in Deutschland (verständlich, wenn ich französische Brühwursten bedenke). Aus den USA kenne ich noch Chitlins, die mich auch eher an Kutteln erinnerten, nur ohne Biss, dafür zähe Darmstücke.
  • Lunge bekommst du heute fast nicht mehr, aber ich kann mich an Lungenhaschee (Beuschel) erinnern, damals schon aus Kalbslunge. Aus Erzählungen kenne ich auch die Lösung, dass Stücke von Kalbslunge anstelle von Schnecken in ein Haus gefüllt und mit Kräuterbutter überbacken wurde. Das kann ich aber nicht beurteilen.
  • Der Rindermagen ist eine gewöhnungsbedürftige Muskelmasse, die als Kutteln gegessen wurden. Dazu wurde der Pansen unmittelbar nach dem Schlachten gründlich gewaschen und mit der Glocke gekratzt und gebrüht. Tat man das nicht, entwickelte der Pansen einen sehr unappetitlich intensiven Geruch.
  • Leber ist bis heute eine wichtige Zutat für Leberwurst, wurde aber auch gebraten (mit Zwiebeln und Apfel zu Kartoffelstampf und Sauerkraut) gegessen.
  • Galle wurde zur Behandlung besonders hartnäckiger Flecken in der Wäsche verwendet. Essen konnte man das wegen des umgekehrten Geschmacks wohl kaum.
  • Nieren wurden gegessen (Schaschlik, saure Nieren...)
  • Rinderherz wird als Einlage in Wursten verwendet, als ganzes verkauft (recht feste Angelegenheit), in der Kochwurst verarbeitet und, wie ich erfahren habe, heute auch als Hundefutter verwendet.
  • Schweineherzen enden wohl häufiger in der Kochwurst.
  • Die Blase gehört zu den Wursthüllen (oben). Daneben verwendete mancher feiner Herr eine aufgeblasene, getrocknete und dann gewalkte Blase mit einer Kordel lange Zeit als Tabaksbeutel.
  • Der Flomen wurde früher gewolft und ausgelassen. Schweineschmalz gibt es auch heute noch, aber die Nachfrage ist erheblich gesunken. Theoretisch könnte es in der Wurst verarbeitet werden, aber im Allgemeinen hat Fleisch auch ohne Flomen schon genug Fett. Es bleibt wohl häufig ein Rest für die Seifenherstellung.
  • Rinderfett emulgiert extrem schlecht, taugt also nicht für die Wurstherstellung. In der Kochwurst setzt Rindertalg mit einer gelblichen, krümmeligen und schlecht schmeckenden Schicht ab. Zudem wird das Zeug unbrauchbarer, je älter das Tier wird und früher lebten die Viecher länger als heute. Ich habe keine Ahnung, was man damit machte.
  • Marktragende Knochen von Rindern und einige der anderen Knochen ("Sandknochen") werden teilweise noch zur Herstellung von Brühe (Knochenbrühe) verwendet.
  • Kalbsknochen wurden geröstet und bildeten mit die Grundlage für eine Mockturtlesuppe.
  • Schweineknochen wurden kräftig angebraten und bildeten die Grundlage für Sossen. Köche können das auch heute noch, wenn sie einen Metzger finden, der ihnen die Knochen verkauft und die ausgebratenen später wieder abnimmt.
  • Was nicht im Kochtopf landete wurde gerne mit Sehnen und Bindegewebsabschnitten in den Leimsiedereien verarbeitet. Das ist auch so eine geruchlich nicht mehr zu vertretende Angelegenheit.
  • Der grösste Teil der Knochen geht heute an die Tierkörperverwertungsanstalten und kommt in Form von Kosmetika, Seifen und Waschmitteln wieder in die Haushalte. Der Rest wird aufgemahlen als Tierfutterzusatz (kalziumhaltig) verwendet.
  • Blut wird noch immer in der Blutwurst verarbeitet. Es fällt aber viel mehr Blut an, als verarbeitet werden kann. Früher liess man das nicht für die Kochwustherstellung benötigte Blut stocken, schnitt es in Würfel und briet es mit viel Fett. Das war unter ältenen Mitmenschen wegen der Konsistenz recht beliebt. Heute wird es in den Tierkörperverwertungsanstalten verwertet.

Du solltest dir aber auch ein paar andere Dinge ins Gedächtnis rufen: Früher war der Fettanteil in Wursten eine Mindeststufe. Fett war für körperlich schwer arbeitende Leute der wertbestimmende Teil der Ernährung. Gleichzeitig gab es davon viel weniger, nur ein reicher Mann konnte täglich Fleisch essen (da werden wir auch wieder hinkommen).

Andererseits hat man früher Hunde-, Vogel- und Menschenkot zum Gerben von Leder verwendet, Urin für das Fixieren von Textilfarben, und Brotmehl mit Sägespänen und Knochenmehl gelängt. Manche Tradition ist es nicht wert, gelebt zu werden.

Bleibt noch dein Nachschlag: Grosse Schlachthöfe leisten sich heute den Luxus eines Seperators. Da gehen Knochen oben rein und unten kommt zerbröselter Knochen und Separatorenfleisch raus. Das Zeug besteht zu einem grossen Teil aus Bindegewbe und Fett, wird aber in wenig hochwertigen Wurstwaren verarbeitet. Was man in Deutschland nicht absetzen kann, wird in Grossbritannien oder Dänemark für eine wurstähnliche Zubereitung verwendet (Bangers and Mash). Dort könnten auch Euter verareitet werden, wenn sie nicht als Konfiskate im Schlachthof verbleiben müssen.

Dagegen leistet sich McDonalds eigene Schlacht und Zerlegebetriebe und produziert meines Wissens nach unter Hygienestandards, die weit über den industrieüblichen liegen. Bei der Vorschriftenhuberei des Konzerns gehe ich davon aus, dass da kein Burger rauskommt, der nicht aufs Zehntel Promille exakt die vorgeschriebene Menge an Fett, Sehnen, Knochen und Fleisch hat. So exakt kann kein mittelständischer Metzger arbeiten: Er wird üblicherweise eine qualitativ bessere Zusammensetzung produzieren.

Der Kunde kann tatsächlich die Qualität von Fleisch- und Wurstwaren kaum beurteilen. Vorurteile wiegen bei Fleisch und Zubereitungen daher mehr. Du kannst deinem Metzger in die Augen sehen, aber nicht dahinter. Aber ganz sicher kannst du im Supermarkt noch nicht mal bis dahin gucken. Äh, Mahlzeit! Yotwen (Diskussion) 05:59, 14. Feb. 2014 (CET) Sollte ich noch ein Körperteil vergessen haben...?

Klitzekleine Ergänzung zu dieser nahezu vollständigen Auflistung: ranziger Rindertalg wurde "früher" im Winter in die Bäume gehängt, so wie heute die Meisenknödel. Geoz (Diskussion) 09:28, 14. Feb. 2014 (CET)
Danke für die Zusammenstellung Yotwen, aber es geht ein wenig am Problem vorbei. Das 25% eines Tieres nicht für den Verzehr geeignet sind, keine Frage. Die Frage ist wohl, wieviel Blutwurst und Ochsenmaulsalat wir heute verzehren, und was die Kalbsknochen angeht, die Preise sind da so utopisch, das Leute wie ich einfach den Knochen vom Kamm oder Kotlett nutzen. Es geht aber vor allem um das, was im Tierfutter landet, nicht in der Chemischen Industrie. Rindertalg - Talglicht, war eine Form des Kerzenersatzes, und da war es egal, ob ranzig oder nicht.Oliver S.Y. (Diskussion) 11:40, 14. Feb. 2014 (CET)
Kerzenersatz? Vor Erfindung des Paraffins aus Erdöl mitte des 19. Jahrhunderts wurden Kerzen nahezu ausschließlich aus Talg hergestellt. Ab 1818 wurde der Talg vorher zu Stearin verarbeitet. --Rôtkæppchen68 18:11, 14. Feb. 2014 (CET)
Talglichter! Danke Oliver. So habe ich auch etwas davon. Leider fallen mir nun bröckchenweise die Auslassungen ein. Beispielsweise wurde früher die Bauchspeichedrüse von Kälbern und Rindern gesammelt und tiefgefroren an ein Pharmaunternehmen geschickt. Die isolierten daraus Insulin, für die Zuckerkranken. Das wird heute von Bakterien im Grorsreaktor gemacht und für die Baucspeicheldrüsen haben wir keine Verwendung mehr. Ich weiss gar nicht, ob es noch andere Hormonpräparate gibt oder gab, die im Schlachtvorgang gewonnen werden. Wenn jemandem etwas einfiele, was man aus Rinderhirnen und -rückenmark machen könnte, dann könnte er ein Vermögen scheffeln. Yotwen (Diskussion) 19:15, 14. Feb. 2014 (CET)
Aus Hypophysen wird Somatropin gewonnen, soviel ich weiß aber nur aus menschlichen. Es gibt auch gentechnisches Somatropin. Das ist allerdings schweineteuer. --Rôtkæppchen68 10:59, 17. Feb. 2014 (CET)
Aus dem Artikel: "Es wurde aus Hypophysen von Toten gewonnen, bis dies Anfang 1985 weltweit verboten wurde". --тнояsтеn 11:10, 17. Feb. 2014 (CET)
Oliver, ich habe das mit etwas Abstand noch einmal gelesen. Ich glaube, deine Frage ist nicht so gut formuliert. Du möchtest wissen, wie viel Lebensmittel 100 kg Kuh früher und heute produzierten.
Plakativ: Wie viele (Lebensmittel)Kalorien wurden früher aus 100 kg Kuh produziert und wie viele produzieren wir heute?
Meiner Meinung nach wurde früher nicht mehr vom Tier verwertet. Kühlungsmöglichkeiten, Kühlkettenmanagement usw. ersparen ja eine Menge Verderb, der früher in Kauf genommen werden musste. Schwänze, Füsse und Ohren verursachen so viel Arbeit, dass der erzielbare Preis kaum kostendeckend sein dürfte. Andere Produkte (beispielsweise Konfiskate) könnten zwar verwertet werden. Die Frage bleibt, ob irgend ein Kunde dann noch bereit wäre, solche Produkte zu kaufen. Niemand möchte eine noch so fein aussehende Fleischwurst essen, wenn sie Augen, Hoden oder sonstiges nicht so apptetitliches enthält.
Viel Material wird heute räumlich anders verwertet. Heute haben wir eine Infrastruktur, die eine Zentralisierung der Verwertung mit sich brachte. Zentrale Tierkörperverwertungsanstalten (TKVA) verwerten eine Menge des Materials, dass ansonsten durch den Metzger selbst hätte verwertet werden müssen. Da bleibt praktisch nichts ohne Verwertung.
Allerdings finde ich dann doch ein Haar in der Suppe. Nicht einmal ich, mit etwas Einblick in die "Szene", weiss genau, welche Produkte TKVA vertreiben, wie viel produziert wird, wer die Kunden sind... Da hätte ich gerne mehr Einblick, denn es liegt im Bereich der Lebens- und Futtermittel. Yotwen (Diskussion) 08:23, 18. Feb. 2014 (CET)
Danke für Deine Kontrolle, aber eigentlich geht auch das in die falsche Richtung. Ich suche erstmal lediglich eine Nährwerttabelle für tierische Körperteile, die nicht in den üblichen Listen stehen. Hab hier mehrere umfangreiche Liste als Print, und im Web gibts ja auch zig Angebote wie [48]. Was die Quoten angeht, so kenn ich die Probleme, das die Zahlen nicht vergleichbar sind. Durch die Zucht haben sich die Tiere so im Aufbau verändert, das man schon 1964 nicht mit 2014 vergleichen kann. Off Toppic - darauf stieß ich bereits in meiner Ausbildung, wo ich merkte, das wir daheim noch Lebensmittel wie Rinderherzen, Hühnermägen und Spitzbeine als normal betrachteten, während das sogar in der DDR Ende der 80er unüblich war/wurde, da zumindest bei Fleisch allgemein eine Voll/Überversorgung bestand (rechnerisch). Zumindest das Rinderherz gibts ja noch in der Liste, und Spitzbeine wurden mit dem Italientrend wieder etwas populärer (Zampone).Oliver S.Y. (Diskussion) 09:05, 18. Feb. 2014 (CET)
so was? Yotwen (Diskussion) 06:15, 19. Feb. 2014 (CET)
Aber eben für die Teile, die es nicht allgemein beim Fleischer gibt.Oliver S.Y. (Diskussion) 13:40, 20. Feb. 2014 (CET)
Na, Ohren und Füsse habe ich gefunden. Rind habe ich nicht mehr geprüft im Vertrauen darauf, dass du selbst lesen kannst und viel mehr Synonyme kennst als ich. Yotwen (Diskussion) 14:03, 20. Feb. 2014 (CET)
Danke dafür, habs schon verlinkt, und werds sicher in unsere Liste hier übernehmen. Aber es ist noch nicht wirklich das, was ich suchte.Oliver S.Y. (Diskussion) 14:47, 20. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:08, 23. Feb. 2014 (CET)

Ist "schon Googlen strafbar"?

Rechtshinweis Bitte den Hinweis zu Rechtsthemen beachten!

Die Polizeiliche Kriminalprävention der Länder und des Bundes schreibt auf http://www.polizei-beratung.de/themen-und-tipps/sexualdelikte/kinderpornografie/rechtliche-grundlagen.html unter anderem:

"Mit der Ausgestaltung als Unternehmensdelikt wird eine Vorverlagerung der Strafbarkeit erreicht: Strafbar macht sich daher bereits derjenige, der gezielt nach entsprechenden Darstellungen sucht (z. B. durch Surfen im Internet), unabhängig von der Motivation. Daher macht sich auch strafbar, wer im Internet nach Kinderpornografie sucht, um dies der Polizei mitzuteilen. Gesetzlich geregelt ist, dass dies selbstverständlich nicht für bestimmte Berufsgruppen in ausschließlicher Erfüllung ihrer dienstlichen Pflicht gilt."

vergl. auch Rainer Leurs: Kinderpornografie: Schon Googeln ist strafbar, Spiegel, 13. Februar 2014

Ist diese Auffassung der Polizei, dass bereits das bloße "gezielte Suchen" z.B. durch Verwenden einer Suchmaschine für nicht-Angehörige bestimmter Berufe strafbar sei, rechtlich haltbar, und gibt es dazu schon Grundsatzurteile? Rosenkohl (Diskussion) 15:14, 15. Feb. 2014

Ich wage jetzt mal den nichtjuristischen Einwand, dass jede Zeit ihre Hexenjagd kennt und 2014 scheint die Jagd auf Kinderpornographen und auf Auslandsgeldbesitzer zu gehen, die Artikel wage ich gar nicht zu verlinken, das könnte ja strafbar sein. Da war doch der Herr Jesus bei der Ehebrecherin („Wer von euch ohne Sünde ist, werfe den ersten Stein auf sie“) verträglicher. --Pp.paul.4 (Diskussion) 15:33, 15. Feb. 2014 (CET)
Jesus sagte aber auch "Lukas 17,2" (sic) --80.108.60.158 15:47, 15. Feb. 2014 (CET)
(BK) Es wäre besser heißt ja nicht man soll das tun. --Hermine Tuzzi (Diskussion) 15:55, 15. Feb. 2014 (CET)
in Österreich stellt der Besitz und das Betrachten eine strafbare Handlung dar. Ein "danach googlen" impliziert also schon einen Missbrauch, und ist daher die Vorstufe zu einer Straftat. --80.108.60.158 15:52, 15. Feb. 2014 (CET)
(BK) Ich halte das so weitgehend nicht für zutreffend. Man könnte sich zum Beispiel vorstellen, daß eine Frau ihre Kinder etwa bei Doktorspielen filmt, weil sie das pädagogisch oder entwicklungspsychologisch interessant findet. Das zu kriminalisieren wäre ein Eingriff in die Forschungsfreiheit, also in ein Grundrecht. --Hermine Tuzzi (Diskussion) 15:55, 15. Feb. 2014 (CET)
Erstmal volle Zustimmung zu Pp.paul. Ich halte für massiv übertrieben, was da betrieben wird. Das Googeln dürfte über den §184(4) strafbar sein: Wer es unternimmt, sich den Besitz von kinderpornographischen Schriften zu verschaffen, die ein tatsächliches oder wirklichkeitsnahes Geschehen wiedergeben, wird mit Freiheitsstrafe bis zu zwei Jahren oder mit Geldstrafe bestraft. "Unternimmt zu verschaffen" kann man als Googeln interpretieren, denn das Ergebnis der (erfolgreichen) Suche beinhaltet ja, dass man bereits "in Besitz" ist, schon wenn das Gesuchte auf dem eigenen Bildschirm angezeigt wird. Besonders krass finde ich, was in dem Spiegel-Artikel erwähnt wird, dass sogar Mangas und Erzählungen betroffen sind (184(4): "tatsächliches oder wirklichkeitsnahes Geschehen wiedergeben"). Hier wird völlig über das Ziel hinausgeschossen: Eigentlich (denkt man jedenfalls...) dient das Ganze primär dem Schutz von Kindern. Wenn sich aber ein Erwachsener eine pornographische Erzählung mit Minderjährigen ausdenkt und diese anderen Erwachsenen zugänglich macht, mag man das als "pervers" etc einstufen, aber es wird niemand ansatzweise geschädigt. Da beginnt mE der Gedankenterror. Solaris3 (Diskussion) 16:04, 15. Feb. 2014 (CET)
Hermine, ich halte es generell für problematisch, Minderjährige bei sexuellen Handlungen zu filmen. Sogar selbstangefertigte Handyvideos für Freund oder Freundin können schnell gefährlich werden, wenn sie in die falschen Hände geraten. Bei Erreichen der Volljährigkeit muss der Selbstfilmer dann alle Videos löschen, weil sie ja dann definitiv strafbar sind. --84.143.223.196 16:13, 15. Feb. 2014 (CET)
In den falschen Händen kann fast alles gefährlich sein. Es ist aber nach meiner Ansicht nicht verhältnismäßig, deshalb fast alles zu verbieten. Welches Rechtsgut soll denn mit dem Verbot von Kinderpornographie geschützt werden? Das sollte doch der Maßstab sein. Wird dieses Rechtsgut bei ansonsten gleichem Sachverhalt nicht verletzt, darf auch nicht bestraft werden. --Hermine Tuzzi (Diskussion) 16:21, 15. Feb. 2014 (CET) PS: Ah, es ist natürlich die sexuelle Selbstbestimmung. Die sehe ich in dem von mir konstruierten Fall nicht gefährdet.
um die Sachlage etwas zu festigen. Meistens sind Personen welche unmündige und schutzbedürftige für sexuelle Handlungen benutzen, selbst aus - "gelinde" gesagt - schrägen Verhältnissen. Neurologisch dürft hier etwas im Antriebsfeld des Hirnes falsch codiert worden sein. Wenn man das Feld der Werbung und seinen unterschwelligen Botschaft für die neuronale Auswirkungen betrachtet, so haben Bilder einen immensen Einfluss auf jene konsumierenden Personen. Wer hier keine psychiatrische Unterstützung hat tut mir echt leid. --80.108.60.158 16:24, 15. Feb. 2014 (CET)
Was den (psycho-)therapeutischen Aspekt angeht, sehe ich das genauso. Damit ist allerdings noch keine Notwendigkeit der strafrechtlichen Verfolgung begründet. Inwieweit der Konsum von einschlägigen Mangas - die wohl selten "wirklichkeitsnahes Geschehen wiedergeben" - die sexuelle Selbstbestimmung von Minderjährigen beeinträchtigen oder gefährden könnte, ist mir nicht klar. Da dürfte der Kommentator wohl einem "Alle solche Perversen gehören weggesperrt"-Impuls erlegen sein. --Zerolevel (Diskussion) 17:19, 15. Feb. 2014 (CET)
Was mir in diesem Zusammenhang noch einfällt: In Fernsehbeiträgen zu diesem Thema werden desöfteren solche Kinderpornographie-Seiten (verpixelt) gezeigt. Machen sich dann auch die Journalisten (im Spiegel-Artikel nicht unter den ausgenommenen Berufsgruppen genannt) strafbar, die solche Sachen für ihre Videos verwenden? --Verwaltungsgliederung (Diskussion) 17:25, 15. Feb. 2014 (CET)
Eher nicht. §184(5): Die Absätze 2 und 4 gelten nicht für Handlungen, die ausschließlich der Erfüllung rechtmäßiger dienstlicher oder beruflicher Pflichten dienen. Damit sind zwar primär vermutlich Polizisten etc gemeint, aber es dürfte auf auf Journalisten lesbar sein. Solaris3 (Diskussion) 17:30, 15. Feb. 2014 (CET)
Und was ist wenn man Kinderpornografie bei Google eingibt (um zum Thema zurückzukommen) um den entsprechenden Wikipedia-Artikel aufzurufen, Google ungeschickterweise aber auch ein paar explizite Bilder einblendet? --Pustekuchen2014 (Diskussion) 17:41, 15. Feb. 2014 (CET)
Then, my dear friend, you are fucked. Nein, Spaß beiseite, es muss ja ein Vorsatz dabei sein, damit es strafrechtlich relevant ist, kein Zufall. Aber dein Beispiel zeigt perfekt, was das für ein Irrsinn ist: Was wäre, wenn du dann aus bloßer Neugier (oder auch: Fassungslosigkeit o.ä.) den ersten Link aufmachst? Schon bist du straffällig. Und da kann auch fast jeder in den Fokus geraten, und dann musst du den Ermittlern und dem Staatsanwalt erstmal klarmachen, wie es eigentlich war. Dieses Gesetz öffnet mE dem Missbrauch, der Willkür und vor allem der Erpressung und Manipulation Tür und Tor. Man muss sich ja nur Herrn Edathy ansehen: Dessen Ruf ist für alle Zeiten erledigt, selbst wenn sich rausstellt (was ich glaube), dass er gar nicht Strafbares getan hat. McCarthy lässt schön grüßen, Orwell haben wir ja bekanntermaßen längst. Ergänzt sich sicher prima. Solaris3 (Diskussion) 17:58, 15. Feb. 2014 (CET)

Allerding dürfte es einige Leute geben die nicht traurig darüber sind das Herrn Edathys Ruf auf alle Zeiten erledigt ist.--Antemister (Diskussion) 22:33, 15. Feb. 2014 (CET)

Schon mit dem Stellen dieser Frage in der Auskunft, machst du dich strafbar, denn dies kann als tauglicher Versuch gesehen werden, Links wie diesen von irgendwelchen Leuten zu erhalten. Grüße --Chricho ¹ ² ³ 17:55, 15. Feb. 2014 (CET)
schön fand ich auch, dass die Polizei sich im Fernsehen angesichts des Ausmaßes der Kriminalität als hoffnungslos überfordert darstellt, was wohl den einen oder anderen angestiftet haben könnte, der Polizei beim Suchen zu helfen... --Heimschützenzentrum (?) 19:22, 15. Feb. 2014 (CET)
Zum Thema „Ausmaß“: http://blog.alvar-freude.de/2014/02/milliardenmarkt.html -- Jonathan 20:51, 15. Feb. 2014 (CET)
Danke, guter Link. Erschreckend, aber nicht sehr erstaunlich. Erinnert mich an den Hype um "Organisierte Kriminalität" Ende der 1990er, da wurde auch ein Zinnober mit gefälschten Zahlen etc gemacht - sollte alles die Überwachung befeuern. Nach 9/11 brauchten sie OK wohl nicht mehr als Rechtfertigung, und das Problem + Begriff starben einen sanften Tod. Oder wurde das in den letzten 5 Jahren irgendwann mal größer thematisiert? Damals schien das Ende der Welt nahe. Solaris3 (Diskussion) 02:35, 16. Feb. 2014 (CET)
Ich bin gegenüber der Rechtsinterpretation des Spiegel äußerst skeptisch. Im Kern läuft das auf imho die Frage hinaus, ob sich eine Information in meinem Besitz befindet, sobald sie mit meinem Dazutun in den flüchtigen Speicher des Computers gelangt ist. (Mit meinem Dazutun, indem ich irgendeinen Link anklicke. Ansonsten befindet sich Kinderpornographie in Form von Datenpaketen in vielen flüchtigen Speichern, bis sie den Weg vom Absender zum Empfänger zurückgelegt hat.) Die gegensätzlichen Sichtweisen über den Stellenwert des Cache werden ja derzeit eher in der Debatte über Streaming ausgetragen. Hier gibt es, wenn auch unter dem Blickwinkel des Urheberrechtes, offenbar eine starke Fraktion, die deutlich zwischen dem technisch begründeten Herunterladen in den flüchtigen Speicher und dem Speichern auf der Festplatte unterscheidet. Allerdings gibt es vom Dezember 2011 ein andersgelagertes Urteil des Amtsgerichts Leipzig gegen kino.to. Ob das Bestand hatte weiß ich nicht und letztinstanzliche Urteile kenne ich auch nicht, habe mich darum aber auch nicht viel gekümmert.
Daß ich durch Suche und das Surfen im WWW es unternehme, im Sinne von § 184 Abs. 4 StGB mir "...den Besitz von (was auch immer) zu verschaffen..." verlangt ja den Nachweis einer Absicht. Ich weiß von keinen wegweisenden Urteilen in dieser Frage. Und angesichts meiner Vermutung, daß man über die Eingabe von "Kinderpornographie" bei Google tatsächlich keine Kinderpornographie sondern nur Berichte und Diskussionen über Kinderpornographie findet, erscheint mir der Spiegelartikel eher als lächerliche Verwirrinformation und Angstmache ohne einen ernstzunehmenden wirklichen Bezug zur Realität. Was ich zur Organisation der Kinderpornographie lese, scheint es (wie bei anderen schwerkrinimellen Strukturen üblich) nur extrem konspirative und verdeckte Organisationsformen zu geben, die auch nur schwer und mit großem Aufwand aufzudecken sind. Wenn ich dies als allgemein öffentlich bekannte Tatsachen ansehe, würde ich mit Vergnügen jeden Prozeß bis zur letzten Instanz vorantreiben, der eine vordergründige Google-Suche zu diskriminieren und zu kriminalisieren sucht. Schließlich sind da ja Grundrechte berührt und von der Kinderpornographie über Google-Suche nach Terrorismus hin zu Drogen hin zu verbotenen politischen Organisationen hin zu regierungskritischen Internetseiten ist es ja immer nur ein kleiner Schritt, wie uns China, Russland, Saudiarabien, Iran und all die anderen Hausmeisterstaaten vorführen.
Bei allen anderen Formen der Suchen nach sogenanntem explizitem Material müßte imho nachgewiesen werden, daß eigentlich nach Kinderpornographie gesucht wurde. Das ist meines Erachtens nur über andere Indizien und Beweismittel möglich, z.B. wenn bei dem Suchenden gleichzeitig auch der Besitz von inkriminiertem Material nachgewiesen wird. Allein aus der Suche heraus wird man imho in den seltensten Fällen einen Beweis führen können. Ich erwarte aber auch nicht, daß in absehbarer Zeit dazu grundlegende Urteile zustandekommen, weil, wie oben bereits angesprochen, in der Regel ja klandestine Ringe und Strukturen ausgehoben werden und dann eine ganz andere Beweislage entsteht.
Fazit: Der Spiegelartikel hinterläßt bei mir den Eindruck von tendenziell wichtigtuerischem Jounalistengeschwätz statt aufklärerischer und informativ aufbereiteter fundierter Sachinformation. --84.191.178.97 05:20, 16. Feb. 2014 (CET)
Wenn der Spiegelartikel Recht hätte - dürfte man dann also auch nicht nach diesem Spiegelartikel gezielt suchen - denn es könnten dann ja auch andere Teffer auftauchen. Chiron McAnndra (Diskussion) 08:41, 16. Feb. 2014 (CET)
http://lmgtfy.com/?q=site%3Aspiegel.de+kinderpornos --Eike (Diskussion) 10:23, 16. Feb. 2014 (CET)
Ihr habt bei euren kritischen Kommentaren oben mE übersehne, dass der Fragesteller keineswegs nur den Spiegel zitiert (von dem man eh nix mehr erwarten kann), sondern mehrere Polizeiquellen bemüht hat: Mit der Ausgestaltung als Unternehmensdelikt wird eine Vorverlagerung der Strafbarkeit erreicht: Strafbar macht sich daher bereits derjenige, der gezielt nach entsprechenden Darstellungen sucht. Nebenbei: Wenn die Polizei anfängt, sich über Rechtsinterpretation auszulassen und neue Gesteze für ihren "großen Fokus" oder so lobt, ist immer Vorsicht angebracht. Und der eingangs zitierte Polizist lobte ganz offen, dass bereits die Suche strafbar wäre, nicht nur der Spiegel. Mutmaßungen über "ist das denn überhaupt beweisbar" sind angesichts der baldigen Einführung der Vorratsdatenspeicherung bei uns eh obsolet. (NSA und BND-Kooperation dazu mal ausgeklammert, kann man zu pol. Erpressungszwecken aber sicher super einsetzen) Solaris3 (Diskussion) 13:00, 16. Feb. 2014 (CET)
Ich glaube, hier werden in der aktuell völlig überhitzten Debatte so viele Punkte vermischt, daß eine rechtskonforme Einschätzung kaum geben kann. Meiner Kenntnis nach erwarb Edathy unter mehreren Mailaccounts, aber immer mit seiner Kreditkarte Produkte eines legalen Verkäufers in Kanada, der zwar wegen Gesetzesverstößen bereits bestraft wurde, aber nicht generell für sein gesamtes Angebot. Wenn ich die Polizeimeldung ganz weit auslege, könnte also schon der Kauf von Produkten in ausländischen "Sexshops" unter das Gesetz fallen, selbst wenn man dort keine entsprechenden Angebote gesehen hat. Ich bin beruflich leider damit randständig beschäftigt gewesen, und staune, daß bislang niemand auf die Rechtslage hinweist. Die "Freiheit der Kunst" wird im DACH bisher so extrem ausgelegt, daß "FKK-Literatur" sowohl eingeführt als auch gehandelt werden darf, unabhängig vom Alter der abgebildeten Personen. Und auch wenn die Staatsanwaltschaft von Abbildungen "vermutlich 9 bis 14 Jähriger" spricht, so heißt das nicht, daß Edathy so etwas besessen hat. Ich hab kein Verständnis für Pädophilie und Mißbrauch von Kindern, aber ich warne ausdrücklich vor einer moralischen Falle, wenn sich herausstellen sollte, daß Edathy zB. Bilder von 15 Jährigen Jugendlichen besessen hat. Das fällt heute unter Homosexualität, nicht unter Pädophilie, und da wird ein Brand ausgelöst, den man wohl nur schwer wieder eindämmen kann, wenn er erstmal auf voller Breite von Hannover bis Berlin lodert. Denn das die Polizei berechtigt ist, auf Verdacht das Onlinekaufverhalten von Homosexuellen zu überprüfen, weil eventuell Kinderpornografie dabei sein kann, die Fiktion kann bald wieder Realität sein.Oliver S.Y. (Diskussion) 14:02, 16. Feb. 2014 (CET)
@Solaris3: Die Polizei macht ihre Politik und erzählt viel, wenn der Tag lang ist. Entscheidend ist dennoch die Gesetzeslage und die Rechtsprechung, die imho noch nicht eindeutig ist und die Behauptungen von irgendwelchen Polizeipressesprechern nicht stützt. Wesentlich problematischer sind für mich Ansätze, wie in diesem Artikel beschrieben: ""Google will härter gegen Kinderpornografie im Internet vorgehen. Künftig werden 100.000 Suchbegriffe blockiert, um die Suche nach einschlägigem Material zu erschweren. Zunächst sind nur englische Begriffe betroffen, mehr als 150 Sprachen sollen folgen. Das Projekt ist Teil einer Kooperation mit Microsoft." Ob das Projekt auch Teil einer Kooperation mit der chinesischen Regierung ist, wird nicht deutlich, würde mich aber auch nicht überraschen, denn der totalitäre Geist ist in meinen Augen der gleiche. Der Zensuransatz über die Provider wie hier in Großbritannien geht aber noch viel weiter. Unter welchen Vorwänden auch immer wird man dann in 5 oder 10 Jahren seine gesamte Persönlichkeit gegenüber dem ISP offenlegen müssen und auch in den Buchhandlungen ein Formular ausfüllen, warum man Orwells 1984 gekauft hat und aus welchem Grunde man das lesen will. Bei einer Reise in den Nahen Osten muß man der Fluggesellschaft gegenüber versichern, daß man mit sogenannten Islamisten keinerlei Kontakt haben wird und im Rahmen einer Extremismusklausel sich per Unterschrift zum Grundgesetz oder was davon noch übrig ist bekennen. Sonst darf man nicht einsteigen... Brave New World. --84.191.178.97 14:35, 16. Feb. 2014 (CET)
„Unter welchen Vorwänden auch immer wird man dann in 5 oder 10 Jahren […] in den Buchhandlungen ein Formular ausfüllen, warum man Orwells 1984 gekauft hat und aus welchem Grunde man das lesen will.“ Vielleicht darf man schon im nächsten Jahr nur noch bei Amazon einkaufen; da braucht man dann auch kein Formular auszufüllen, denn die wissen so schon, warum man 1984 lesen will. Eigentlich braucht ein Staatsfeind 1984 gar nicht mehr zu verlangen, um sich verdächtig zu machen, denn ob er es lesen will, weiß Amazon ja allbereits jetzt. Man könnte also, um unseren Staat sicher zu machen, ganz einfach alle einsperren, von denen man über ihr Surfverhalten weiß, daß sie bestimmte Straftaten begehen wollen. Leider hinkt unsere Politik (die Merkel-Regierung, die Bayern, die Wirtschaftslobbys, die Achtundsechziger…) der Wirklichkeit mal wieder um Jahre hinterher oder ist einfach zu feige, geeignete Maßnahmen zu ergreifen, um uns vor Pädophilen, Terroristen und anderen kranken Spinnern zu schützen. Die da oben könnten sich ruhig mal wieder die Skandinavier zum Vorbild nehmen: Da wird bald endlich das Bargeld abgeschafft: so kann sich niemand mehr unbemerkt die Mittel und Werkzeuge zu Verbrechen beschaffen, und Steuerhinterziehungbetrug wird auch so gut wie unmöglich. Ein Bedürfnis nach anonymem Zahlungsverkehr haben heutzutage sowieso nur noch Kriminelle. Und wer nichts zu verbergen hat, hat ja auch nichts zu befürchten, oder? --Hermine Tuzzi (Diskussion) 14:53, 16. Feb. 2014 (CET)
Man kann mit einer Tastatur oder einem Bildschirm kein Kind vergewaltigen. Das geht prinzipiell nicht, weil man weder mit Bits, noch mit TCP-Paketen ein Kind schädigen kann. Schade ist, dass unsere Bundesregierung so fleißig sich um dieses moderne Interent kümmert, aber absolut nichts dageben unternimmt, dass die Kinder weiterhin von ihren eigenen Vätern und Stiefvätern oder von Onkel und Opa vergewaltigt werden. Die Vergewaltigung ist mit oder ohne Bild gleich schmerzhaft. Übrigens hat sich unsere Bundesregierung noch zusätzlich den Spaß erlaubt, das Opferentschädigungsgesetz so zu schreiben, dass die Opfer kaum eine Chance haben. Was meinen unsere Politiker denn eigentlich, mit welcher Frechheit und Dreistigkeit sie hier vorgehen können, bis die ersten Opfern sich melden, um ihnen eins aufs Maul zu hauen. Hier geht es ausschließlich darum, das Internet zu überwachen und zu kriminalisieren. Die missbrauchten Opfer wurden vor allem vom Vergewaltiger missbraucht. Nunmehr werden sie intensiv von der Bundesregierung missbraucht, um bei der Errichtung eines Polizeistaates gegen deren Willen behilflich zu sein. Am wenigsten wurden sie von den Konsumenten der Bilder missbraucht. Alle drei Sachen sollten verboten sein, aber doch ganz sicher nicht das Googeln danach!!!. -- Auskbeo (Diskussion) 15:32, 16. Feb. 2014 (CET)
@84.191...: Natürlich ist mir klar, dass die Polizei keine juristischen Kompetenzen hat. Das Problem ist, dass wir in diesem land eine lange Historie von Fällen haben, wo Strafverfolgungsbehörden inkl. der Staatsanwaltschaft ihre Kompetenzen überschritten haben und dadurch Existenzen gefährdet, zerstört oder mindestens Reputationen zerstört haben (siehe etwa Klaus Traube). Und im Fall Edathy sieht man ja exemplarisch, wie das funktioniert. Fällt übrigens nur mir auf, dass hier nicht die Karriere von irgendjemand zerstört wird, sondern von einer der zentralen Personen in der Aufklärung der größten Geheimdienstaffäre in der Geschichte der Bundesrepublik? Da muss man wirklich nicht besonders 'verschwörerisch' denken, um ganz andere Motivationen zu vermuten als einen angeblichen 'Kinderpornografen' zur Strecke zu bringen. Sowas (Blackmailing, Desinformation) ist "Standard Operating Procedure" von Geheimdiensten. Ach ich vergaß, in der heimeligen Mutti-Republik gibt es solche bösen Dinge ja nicht... Solaris3 (Diskussion) 16:02, 16. Feb. 2014 (CET) Nachtrag: Wie man am weiteren Verlauf der Disk sieht: Nein, es fällt niemand auf. Man springt lieber intensiv und wiederholt über das medial hingehaltene Stöckchen. Stöhn. Solaris3 (Diskussion) 17:07, 16. Feb. 2014 (CET)
(BK) Sorry, aber was ist denn das für ein Schwachsinn? "Man kann mit einer Tastatur oder einem Bildschirm kein Kind vergewaltigen", nach diesem Motto wäre Kinderpornografie also vollkommen in Ordnung, weil derjenige, der sich diese Bilder oder Videos ansieht hat ja keinem Kind körperlich direkt etwas getan??? "Die Vergewaltigung ist mit oder ohne Bild gleich schmerzhaft", es macht also überhaupt keinen Unterschied, wenn ein Kindesvergewaltiger seine Taten auf Video aufzeichnet und im Internet verbreitet, damit sich noch mehr Pädophile daran aufgeilen können??? Kindesmissbrauch durch die eigenen Eltern ist ja schon abartig, aber Kinderpornographie ist nochmal eine ganz andere Hausnummer...--178.7.178.24 16:03, 16. Feb. 2014 (CET)
Natürlich macht es einen großen Unterschied, ob die Taten mit Bild oder Video aufgezeichnet sind. Es macht aufgrund des grenzenlosen Zynismus dieser Bundesregierung sogar einen sehr großen Unterschied. Hat das Opfer nämlich kein Bild, bekommt es sehr oft auch keine Hilfe und wird nach 3 Monaten zwangsgeräumt. So denkt unsere Bundesregierung. Und meinst du wirklich, dass ein Opfer, das als Kind eine Vergewaltigung erleiden musste, eine Debatte über die "Bildrechte" nachfollziehen kann, während dem Opfer droht, dass es zwangsgeräumt wird? Letztendlich geht es der Polizei um Verdachtsgenerierung, nicht um Verhinderung einer Straftat. Ob es ok ist Kinderpornos anzusehen kann ich dir nicht sagen. Fantasie muss frei bleiben, auf der anderen Seite könnte die Gefahr bestehen, dass jemand hierdurch erst zum Täter wird. Das hatte aber der Fragesteller nicht gefragt. Willst du diese Frage stellen? Ich beteilige mich gerne an der Debatte. --16:22, 16. Feb. 2014 (CET)
Es geht hier um real existierende Bilder/Videos, auf denen echte Kinder dargestellt werden. Das hat mit Fantasie nichts mehr zu tun. Wenn jemand die Fantasie hat, mit Kindern Sex zu haben ist das bedenklich genug, wenn derjenige sich aber entsprechendes Material besorgt, dann ist das vollkommen zu Recht verboten. Und es geht mir nicht im geringsten um Bildrechte, es geht darum das es deiner Aussage nach keinen Unterschied mache ob jemand ein Kind vergewaltig, oder ob er davon auch noch Bilder/Videos aufnimmt, diese ins Internet stellt und damit womöglich noch Geld verdient. Und die Aussage, man könne mit Bildschirm und Tastatur kein Kind schädigen ist mit der größte Müll, den ich hier je gelesen habe. Kinderpornografie ist zu Recht verboten, und kein normaler Mensch versucht sich solche zu beschaffen, schon gar nicht "zufällig" oder "unabsichtlich". Dafür das du auf Google "Kinderpornografie" eingibst um den entsprechenden Wikipediaartikel zu finden und dich zu informieren wirst du sicherlich nicht vor Gericht landen. Zumal dir Google auch keine einschlägigen Ergebnisse liefern wird, erstens weil Google derartiges Material blockiert (jaja, Zensur, aber in diesem Fall durchaus berechtigt), zweitens weil auch die Anbieter leider nicht ganz dämlich sind, und derartiges nicht öffentlich zugänglich (und damit für Polizei und Behörden auffindbar) machen, sondern dafür andere Kanäle nutzen, Stichwort Tor.--178.7.178.24 16:50, 16. Feb. 2014 (CET)
Auf KiPo-Herstellerseite hast du es mMn mit den wohl übelsten Formen des menschlichen Daseins zu tun. Auf Konsumentenseite ist das tatsächlich Fantasie. Sehr viele pädosexuelle Menschen werden pädokriminell und alles andere wäre blauäugig, das ist richtig. Aber nach einer Vergewaltigung gehen zwei Personen ins Internet. Das ist zum einen der Täter, das ist aber auch das Opfer, welches die Tat nicht einordnen kann, welches über die Tat nicht sprechen kann und ähnliche Bilder dem Arzt vorlegt, damit es nicht erzählen muss. Weitere Personen, die ins Internet gehen, sind Angehörige, die nicht glauben können, dass es so etwas gibt und es erst glauben, wenn sie so ein Bild tatsächlich sehen. Daneben aber auch übermütige Jungs (mit Papas Rechner?). Ich finde die Diskussion schon interessant, würde gerne weiter antworten, ich will aber dem Fragesteller die Diskussion nicht zuspammen. -- Auskbeo (Diskussion) 17:02, 16. Feb. 2014 (CET)
Die Fantasie ist wie gesagt bedenklich, aber eben nicht verboten. Nur wenn sich jemand entsprechendes Material besorgt geht das über die Fantasie hinaus und wird real und damit richtigerweise strafbar. Und das ein Kind sich Kinderpornografische Bilder besorgt um den Arzt zu zeigen was passiert ist auch Schwachsinn. Die Tat an sich ist für das Opfer traumatisierend genug, Bilder oder gar Videos davon anzusehen sind da keine Hilfe sondern verschlimmern die Situation nur noch. Wer als Angehöriger in der heutigen Zeit noch glaubt, soetwas wie Kinderpornografie gäbe es nicht, der ist auch durch entsprechende Bilder nicht zu überzeugen. Die traurige Wahrheit ist, das solches Material existiert, und durch die Medien ist das auch jedem bewusst, ohne das man es aus erster Hand gesehen haben muss. Übermütige Jungs suchen vielleicht gewöhnliche Pornos, die zudem auch mit Google auffindbar sind, aber wie gesagt, Kinderpornografisches Material wirst du dort nicht finden. Und dazu dass sich jugendliche Tor-Zugang einrichten und entsprechende Seiten auffinden gehört schon etwas mehr dazu als nur Übermut.
Ich finde deine Argumentation hier ehrlich gesagt wesentlich bedenklicher als ein Verbot, nach Kinderpornografie zu suchen. Damit könnte sich ja dann jeder, der wegen der Verbreitung von Kinderpornografie vor Gericht steht damit rechtfertigen, dies sei ja nur zu Informationszwecken gedacht gewesen.--178.7.178.24 17:20, 16. Feb. 2014 (CET)
Wären im Netz solche Bilder mit Google frei auffindbar, dann hätte ich auch ein ganz ernsthaftes Problem (Retraumatisierung). Das sind sie aber erstens nicht und zweitens brauche ich zum Zeigen nur ähnliche Darstellungen mit Erwachsenen und diese sind vollkommen aus dem legalen SM-Bereich.Es ist nur ein Unterschied, ob man schön zuhause sitzt, oder ob man solche Begriffe ins Netz eingeben muss und sich dann Sorgen machen muss, weil irgendein Polikerarschloch wieder einmal intensiv NICHT an die Opfer gedacht hat, die aus dem Netz auch ihre Infos ziehen müssen und die gleichen Begriffe wie die Täter eingeben werden.
Erwachsene Menschen, die als Kind vergewaltigt wurden, können sehr lange Zeit darüber nicht sprechen und meist noch nicht einmal daran zurückdenken. Erst wenn diese erwachsen sind, wenden sie sich dem Thema zu und werden von der Polizei gleich mehrfach bedroht. Zum einen droht ihnen die "Zwangsaussage" und somit die Retraumatisierung, weil es ein Offizialdelikt ist. Zum anderen können sie sich dank Zensursula nicht frei im Internet erkundigen. Wenn jemand selbst als erwachsener Mensch nicht mehr Sprechen kann, was glaubst du wie viel Spaß derjenige hat die Begriffe "Inzest, very young, rape" ins Internet einzugeben und wie sehr er sich nun auch noch von der Polizei bedroht fühlt. Was soll er sagen, wenn sie klopfen? Dass er Opfer ist? Wird sie ihm glauben? Und wenn sie ihm glauben, dann wird sieh in Befragen bis er retraumatisiert ist! Was glaubst du, wie viel Hass so ein Opfer auf Zensursula hat. Und jetzt also auch noch die Kriminalpolizei. Ich könnte nur noch Kotzen. Aber nun zurück zu dir: Wie soll ein Opfer, das weder von der Tat sprechen kann, noch schreiben kann und vielleicht nur eine vage Vorstellung hat, was damals passiert sein könnte (wie gut ist deine Erinnerung an deine ersten 4 Jahre) seinem Arzt mitteilen, dass eine Vergewaltigung gar nicht so lustig ist, wie allgemein angenommen und mit sehr viel Ekel verbunden? Wenn du ihm die Bilder zeigst, dann ist der inkompetente männliche Volltrottel zumindest einmal so geschockt, dass er eine Klinikeinweisung vornimmt und so kann man als Opfer der nächsten Fehlbehandlung entkommen. Alles nicht so lustig als Opfer, verstehst du? Aber danke für deine ehrliche Empörung. (PS: Wo untersützte ich Täter?) -- Auskbeo (Diskussion) 17:41, 16. Feb. 2014 (CET)
  • Was meinst du, wo man als Opfer denn Infos herbekommt? Aus dem FREIEN Internet natürlich!!!!
  • Was meinst du, wer dir als Opfer hilft? Keine einzige SAU!!!!!
  • Zu wem gehst du? Wildwasser (Anrufbeantworter), Kripo (Spezialberatung gerade nicht besetzt). Aus meiner Verzweiflung bin ich zur kath. Kirche und glaube mir, ich tat es nicht gerne (siehe Kinderschänderskandal in Kirche) zur TherapeutIn (3 Monate Wartezeit).
  • Meinst du, du triffst einen einzigen Täter, wenn du das Interent zensierst? Die Lachen über dich!
  • Wo haben sich die Opfer gefunden? Im FREIEN Internet, weil ihnen nun einmal keine Sau helfen wollte.
  • Warum schafft es die Bundesregierung ab? Weil sie so pervers sind, so abartig, dass sie überhaupt kein Problem damit haben, den Opfern die bisher einzige Möglichkeit zu nehmen, sich Hilfe zu holen.

-- Auskbeo (Diskussion) 17:53, 16. Feb. 2014 (CET)

(BK) Ich wiederhole: Nur weil du "Kinderpornografie" auf Google eintippst (kannst du ja gerne mal probieren) landest du noch auf keiner Kinderpornoseite. Da gehört schon wesentlich mehr suchen auf ganz anderen Kanälen dazu. Im moment kommt bei mir zuerst der Wikipediartikel gefolgt von Nachrichtenseite mit dem Fall Edathy. Wie gesagt, auch die Anbieter sind leider nicht ganz blöd und stellen ihr Material für jeden (und damit auch die Polizei) leicht zugänglich ins Netz. Das ein solcher Missbrauch für die Betroffenen sehr traumatisierend ist ist mir klar, auch wenn ich mir wohl kaum vorstellen kann wie sehr. Aber denkst du wirklich da hilft es weiter, wenn diejenigen Bilder oder Videos von solchen Misshandlungen sehen? Weiter, wenn du "Kinderpornografie -Edathy" eingibst, also den aktuellen Fall ausdrücklich ausschließt, liefert dir Google sogar Foren für Opfer von Kindesmissbrauch, auf denen sich die betroffenen darüber austauschen können. Von Zensur kann da also keine Rede sein. Wenn du einem Arzt erst Aufzeichnungen von Missbrauch zeigen musst, damit ihm klar ist das eine Vergewaltigung nicht lustig ist, dann hat dieser in seiner Ausbildung aber etwas ganz gewaltig falsch gemacht. Das sollte jedem erwachsenen Menschen klar sein, jemandem der beruflich mit den Opfern zu tun hat erst recht. Was der "inkompetente männliche Volltrottel" mir sagen soll ist mir schleierhaft. Und ich schrieb nirgends das du die Täter unterstützt, lediglich das diese deine Argumentation zum Schutz missbrauchen könnten im Sinne von "Aber ich hab die Videos doch nur Online gestellt, damit Angehörige von Opfern sich darüber informieren können".--178.7.178.24 18:06, 16. Feb. 2014 (CET)
(Nach BK) Es geht doch gar nicht darum, das Internet "unfrei" zu machen oder zu zensieren. Es heißt audrücklich "Wer gezielt danach sucht", da gehört eben mehr dazu als sich darüber zu Informieren oder sich als betroffener Hilfe zu suchen oder mit anderen auszutauschen.--178.7.178.24 18:08, 16. Feb. 2014 (CET)
Das Opfer eines sexuellen Missbrauch muss einen Spießrutenlauf durch ingesamt 2-3 Ärzte machen, bis es Hilfe bekommt. Du gehst von falschen Voraussetzungen aus. Ich erinnere mich noch genau daran, dass ich mir als Kind dachte "Der bringt mich um". Danach setzt meine Erinnerung aus. Warum? Hatte der Täter mir seinen Penis so massiv in den Mund gesteckt, so dass ich keine Luft mehr bekam? Hat der Täter mich gewürgt? Wie gehen Täter normalerweise vor? Ungeschicktheit eines sexuellen Ausbeutungstäters oder Mordversuch? Oder war der Täter gar kein Pädophiler oder Mörder, sondern ein Sadist, der genüßlich meine Bewußtlosigkeit inszenierte. Kannst du das mal schnell für mich googeln? Ich war damals außer mir und bräuchte ein paar Fotos, um das Einordnen zu können. Gebe bitte die Begriffe "extrem torture" oder "sadistic rape" ins Internet ein, schau dir die Bilder und die Videos an (das bitte über mehrere Stunden hinweg). Und schicke sie mir doch bitte per email. Danke. (Und falls das BKA klopft, dann kannst du das ja erklären, oder? War ja keine gezielte Suche, is also kein Problem). Meine inkompetente weibliche Therapeutin ist der Meinung, dass Kinder leider sehr gerne so eine Vergewaltigung aufgrund Überforderung als Mordversuch einordnen. Mein Zahnarzt widerspricht sehr heftig und meinte, dass sehr häufig orale Vergewaltigungen von den Tätern bis zu Bewußtlosigkeit fortgeführt werden, also meine Erinnerungen vollkommen richtig sein könnten.
Und ich soll das in einem Opfer-Chat fragen? Wie bitte? Opfer-Chat? Vielleicht von Wildwasser? Und da sitzt dann eine verheulte Soz-Päd am Lösch-Button. Oder soll ich mit einer ebenso verheulten Therapeutin im private Chat sprechen, die einem erklärt, dass Opfer sich da gerne auch mal täuschen. Du glaubst doch nicht, dass diese feige weibliche Therapeutin bereit war sich mit der harten Wirklichkeit zu konfrontieren, oder? Was meinst du denn, warum die Psychologie studiert hat und nicht Polizistin geworden ist? Und was glaubst du bitte, um wie viel die Vergewaltigungsraten sinken, wenn die Täter keine Fotos mehr machen dürfen? Weißt du was, die Täter scheißen drauf, vergewaltigen trotzdem und kümmern sich nicht um das Foto-Verbot. -- Auskbeo (Diskussion) 01:02, 17. Feb. 2014 (CET)
Ich bin heilfroh, dass die Täter irgendwelche Fotos ins Netz gestellt haben, sonst würde mir das die feigen und inkompetenten Therapeuten doch alles gar nicht glauben wollen. Wenn du mein Foto findest, kriegst du von mir 1000 Euro bar. Aber bitte beeile dich! Ich will nicht aus meiner Wohnung und mein Geld wird knapp. Wenn das OEG übernimmt, dann bin ich für den Rest des Lebens versorgt. Du willst nicht? Weil du dich strafbar machst? Du weißt nicht, wie man sich anonymisiert? Dann bist du kein Täter, denn die wissen das meistens. Ich weiß nicht, was hinter diesen komischen Gesetzen steckt, aber um die Opfer oder um die wahren Täter geht es hier ganz sicher nicht. -- Auskbeo (Diskussion) 01:22, 17. Feb. 2014 (CET)
Die Parteien und die Polizei haben Mythen über kindliche Vergewaltigungen verbreitet. Diese Mythen leben alle davon, dass sich die Opfer nicht zu Wort melden können und dem widersprechen können. Es ist anders, viel normaler, viel ekelhafter aber ohne diese Sensation und diesen Hype. Der Hype darum wird absichtlich erzeugt, um es für eigene Zwecke einsetzen zu können. Wo ist denn der Unterschied zwischen einem Banküberfall (auch da ist man in der Gewalt und muss vielleicht den Geruch des Täters ertragen) und einer Vergewaltigung? Der Unterschied liegt im höheren Ekel während der Bankangestellte vermutlich intensiver mit dem Leben bedroht wird und dafür aber nicht so viel Ekel ertragen muss. Stellt euch bitte eine Vergewaltigung näherungsweise wie einen Banküberfall oder einen Mordanschlag vor, dann merkt ihr, was die euch für einen Blödsinn erzählen. Das ist kein "mediales Stöckchen", sondern eher eine große Sauerei. -- Auskbeo (Diskussion) 05:01, 17. Feb. 2014 (CET)
Glaubst du wirklich, dass ein Banküberfall und eine Vergewaltigung für das Opfer dasselbe bedeuten?--SFfmL (Diskussion) 19:45, 18. Feb. 2014 (CET)
Glaub ich nicht nur, weiß ich. Schwerer Banküberall ist wie schwere Vergewaltigung. Unterschied ist aber, dass es kein Problem ist, wenn man keine Bank mehr betreten kann, aber ein großes Problem, wenn man sich von seinem Partner nicht mehr anfassen lassen will. Von der traumatischen Situation her ist das aber ähnlich. Nach der absoluten Todesangst kommt nichts mehr. Der Ekel bei Vergewaltigung entsteht eher danach (vorausgesetzt mit Leben bedroht worden bei Vergewaltigung). Gegenfrage: Wie stellst du dir so eine Vergewaltigung vor (z.b. als 4 jähriges Kind). Du bist Sozialpädagoge? Vielleicht von einem Opferverband gar? Eine Psychologin? Ihr wisst alle so gut Bescheid, dass ihr nicht ein einziges Mal zuhören könnt. Und falls du ein normaler User bist: Warum interessiert es dich (nur so, nicht bös gemeint)?-- Auskbeo (Diskussion) 21:57, 19. Feb. 2014 (CET)

Danke für das Interesse und einige Antworten, insbesondere auch die Beiträge von 84.191.178.97. Um einmal selbst auf die eingangs gestellte Frage einzugehen, das Oberlandesgericht Hamburg hat am 15. Februar 2010 eine Person verurteilt. Dazu heißt es unter [49]:

"Kinderpornografie muss man nicht bewusst abspeichern, um sich strafbar zu machen – schon das Betrachten am Bildschirm genügt [...] Der Täter hatte sich kinderpornografische Bilder im Internet angeschaut, herunterladen wollte er sie aber nicht. Dass er beim Surfen automatisch Bilder auf der Festplatte zeitweise (im „Cache“) zwischenspeichert, habe er nicht gewusst."

Ich interpretiere den Bericht so, daß das Zwischenspeichern auf der Festplatte in diesem Fall als Beweismittel gegen den Angeklagten verwendet wurde, aber der Schuldspruch durch das Gericht erfolgte wegen des bloßen Betrachtens, nicht wegen des automatischen Abspeicherns. Vermutlich ist dies die bislang höchstinstanzliche betreffende Entscheidung.

Damit ist aber noch nicht genau beantwortet, ob das bloße "Googlen", also Starten einer Anfrage bei einer gängigen Suchmaschine, und betrachten des gelieferten Resultats, bereits strafbar sein kann, Rosenkohl (Diskussion) 23:49, 18. Feb. 2014 (CET)

Nachdem ich dir die Frage geschrottet habe, hab ich's schnell für dich nachgegoogelt.
Bloßes Googeln zur Besitzverschaffung ist auf jedenfall strafbar. (Was meinst du denn, warum ich mich so aufrege! Damit treffen die Idioten genauso die Opfer. Die Täter werden aber werden wieder einmal weiträumigst geschützt. Die müssten nur klipp und klar einführen, dass Nacktbild von Kind GEGEN GELD immer strafbar ist und alles andere straffrei lassen. So würden sie den Sumpf austrocknen. Aber genau das wollen die Politiker nicht. Sind doch selber viele pädophil. Die GRÜNEN wollten Sex mit Kindern teilweise sogar straffrei machen)
I. Die Besitzverschaffungs- und Besitztatbestände in §§ 184b Abs. 4, 184c Abs. 4 StGB Verboten und strafbar ist nach § 184b Abs. 4 S. 1 StGB bereits das Unternehmen (§ 11 Abs. 1 Nr. 6 StGB), sich den Besitz kinderpornographischer Schriften (§ 11 Abs. 3 StGB) zu verschaffen, sofern diese ein tatsächliches oder ein wirklichkeitsnahes Geschehen wiedergeben (was letztlich nur bei foto- bzw. videographischen Darstellungen der Fall sein kann2). Es geht also um Darstellungen, die (1) sexuelle Handlungen3 von, an oder vor Kindern (Personen unter 14 Jahren4) zeigen, (2) pornographischen Charakter haben5 und denen (3) ein realer Vorgang (mit „echten“ Darstellern entsprechenden Alters) zugrunde liegt oder jedenfalls nach dem äußeren Gesamteindruck („wirklichkeitsnah“) zugrunde zu liegen scheint. Sich den Besitz einer derartigen „Schrift“ zu verschaffen, ist nach § 184b Abs. 4 S. 1 StGB generell verboten und strafbar. Der Tatbestand lässt es insoweit schon genügen, dass sich jemand den Besitz zu verschaffen unternimmt. Das bedeutet im Ergebnis, dass die Strafbarkeit bereits beginnt mit dem unmittelbaren Ansetzen zum Versuch (§ 22 StGB), sich den Besitz jener Schriften zu verschaffen
Ich glaube, Pädokriminelle können das aber irgendwie umgehen, indem sie den Browser-Cache deatkivieren und nur in den Arbeitsspeicher laden und das dann danach löschen. Dadurch kein Besitz und dadurch auch keine versuchte Besitzerschaffung. Darfst du aber gerne selber nachlesen. http://zis-online.com/dat/artikel/2011_4_545.pdf
-- Auskbeo (Diskussion) 21:46, 19. Feb. 2014 (CET)
Und wenn das Material zwischen den Pädophilen ohne Bezahlung weitergegeben wird ist das ganze also in Ordnung?--188.98.193.49 08:48, 20. Feb. 2014 (CET)
Oben schreibt jemand, dass ja schon familiärer Missbrauch schlimm genug wäre, aber Kinderpornographie geht ja nun mal absolut gar nicht. Das bedeutet im Klartext, dass dieser jenige es zwar für bedenklich hält, dass ein Vater (wir sind beim familiären Missbrauch) dem 2jährigen Kind seinen Penis in die Vagina steckt, bis die Vagina zerreißt oder zumindest bis das Baby aus Schmerz und Todesangst in Ohnmacht fällt. Aber das Betrachten von Bildern hält er für das Infernal des Bösen und empört sich (so ein wenig familiärer Missbrauch is aber nich ganz sooo schlimm - bleibt ja in der Familie). Ja, was soll ich dazu noch großartig sagen. Ich denke diese Logik spricht Bände und zeigt, welchen Verblödungsgrad die Bundesregierung in der Bevölkerung bereits erreicht hat. Lustig ist, dass ich sogar als Opfer attackiert werde. Du von mir aus: "Halt eine Waffe an den Kopf und BITTE BITTE drück ab". Ich habe aber etwas dagegen, wenn genau die Leute, die mir als einzige wirklich geholfen haben (Chaos Computer Club indem sie für ein freies Interent sorgen und mir gezeigt haben, wie ich meine aufgezeichneten Therapiestunden verschlüsseln kann) kriminalisiert oder gar pönalisiert werden. -- 20:22, 20. Feb. 2014 (CET) (ohne Benutzername signierter Beitrag von Auskbeo (Diskussion | Beiträge))
Liest du eigentlich auch was du selber schreibst? Zuerst ist Kinderpornografie im Internet gar kein Problem, weil man mit Bildschirm und Tastatur ja keinem Schaden zufügen kann. Zudem brauchen ja die Opfer kinderpornografische Videos, weil der Arzt/Therapeut sonst keine Ahnung hat wovon man redet. Dann stellt sich die Regierung gegen die Opfer, weil sie Kinderpornografie und jegliche Verbreitung derselben verbieten will. Als nächstes stellst du die Vergewaltigung eines Kindes auf die selbe Stufe wie einen Bankraub. Und jetzt soll deiner Meinung nach die Bezahlung verboten werden, was kostenfreien Austausch im Gegenzug legal machen würde? Niemand attackiert dich als "Opfer", aber deine Argumentation ist nunmal nicht sehr nachvollziehbar, geschweige denn überzeugend. Gelinde gesagt finde ich deine Argumente sind Unsinn, ganz unabhängig davon ob du behauptest ein Opfer zu sein oder nicht.
Und den Beitrag auf den du dich beziehst solltest du vielleicht nochmal genau lesen. Dort wird mit keinem Wort Kindesmissbrauch verharmlost, schon gar nicht kann die Rede von "so ein wenig familiärer Missbrauch is aber nich ganz sooo schlimm - bleibt ja in der Familie". Es steht dort legiglich, das die Aufnahme von Videos und Bildern der Tat sowie die Weitergabe an Pädophile das ganze noch schlimmer macht - das bedeutet aber nicht, das im Umkehrschluss die Tat ohne Video/Bild in Ordnung ist und der Täter nicht hart bestraft werden soll.--188.98.193.49 20:47, 20. Feb. 2014 (CET)
Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 00:10, 23. Feb. 2014 (CET)

Wellentheorie // Wellenpraxis : Wellenkugeln, EM, QM, QT, QFT QCD - Beispiele gesucht

hi, suche immer noch Wellenphänomene, die topologisch / raumzeitlich / ganz real / über die physikalische Beschreibung hinausgehen / jenseits der Wellengleichungen liegen / über das °betrachtete System° hinausgehen: und zwar sich ablösen von der Welle, so, wie Tropfen aus Wasserwellen entstehen. Es können auch spindelförmige, ellipsoide, ringförmige, kreis-/ellipsenförmige, komplex geformte °Ablösungen° von der Welle / vom Wellenfeld / Ablösung von Feldlinien sein. Aber real oder real anwendbare Modelle (zB Feldlinien). Dafür dürfen es und sollen sogar Beispiele einer beliebigen Wellenart (quantenfeldtheoretisch, elektromagnetisch, elektrisch, magnetisch, quantenchromodynamisch, Gravitationsfeld) sein.
Kugelwellen, also kugelförmige Ausbreitung einzelner Wellenberge sind nicht gemeint!

  • Ein Kugelblitz wurde jüngst als irgendeine Art von Verbrennung von Schwefelgasen gefilmt und gedeutet - ist in der Form also eine verbrennende kugelähnliche Gas-Verwirbelung immerhin. In der Form jedenfalls kein °elektromagnetischer Kugelblitz°.
  • Vielleicht gibt es zwischen zwei schwingenden Dipolen in geeigneter Anordnung kugel- oder gerundet rautenförmige in sich geschlossene Zusammenflüsse von Feldlinien? Elektromagnetische Verwirbelungen der Feldlinien?
  • Kann man die Masse der W und Z-Bosonen als kugelförmige Wellenbildung des Higgs-Feldes begreifen?
  • In der Ergosphäre swLöcher oder eher in eng & schnell sich umkreisenden Doppel-swLöchern entstehen heftige Verwirbelungen der Raumzeit selbst (!), wenn solche auch kugelförmig sich ablösen könnten - liegt doch nahe? - , wie gingen die Feldgleichungen / Physik damit um, formalistisch?
  • Können Tesla-Spulen in geeigneter (ggf komplexer) Anordnung rein elektrische (?), elektrostatische (?) Verwirbelungen generieren?
  • Gibt es auf atomarer, subatomarer, gar Quantenebene Verwirbelungen der Felder?
  • Es dürfen auch Beispiele sein, wo wie beim Kugelblitz, nicht das Wellenfeld selbst bzw darin bewegte Energien, Welle-Teilchen wogen, sondern in Wechselwirkung mit Medium, Material, anderen Kräften Kugeln aus verwirbelnden Wellen entstehen ..
  • irgendwas, womit ich °arbeiten° kann ;o]) --217.84.127.174 02:38, 14. Feb. 2014 (CET)
  • Und ich weiß noch immer nicht, was wellentechnisch betrachtet ein von einer Wasserwelle gelöster Wassertropfen ist - wenn es schon ad hoc keine Formel dafür gibt. Hat er °das betrachtete System° "verlassen"? Ist die Welle °kaputt° aus physikalisch-formalistischer Sicht? Gehört der Tropfen nicht mehr zur betrachteten Welle? Ist Physik nicht mehr zuständig, weil es ein komplexer makroskopischer Vorgang ist, sondern die Chaostheorie? Geht nicht auch Information über eine Welle verloren, die ein von ihr gelöster Wassertropfen °mitnimmt° (let alone black holes)? Welche Disziplin, welcher Formalismus, welches Modell ist zuständig für Wassertropfen aus einer Welle Physik (?), Strömungslehre (?), Chaostheorie & Komplexitätstheorie (?), angewandte Topologie (?), Systemtheorie (?), Gruppentheorie der Wassermoleküle (?), Mengenlehre :o|=] ? Danke soweit! --217.84.127.174 02:38, 14. Feb. 2014 (CET) Wellengleichung#Die_Wellengleichung_in_drei_r.C3.A4umlichen_Dimensionen Gilt die auch für Tropfen? Kann diese °ebene, sich kugelförmig ausbreitende Kugelwelle° sich auch richtig überschlagen? --217.84.127.174 02:52, 14. Feb. 2014 (CET)
zur Vertiefung der Thematik würde ich diesbezüglich in die anerkannte Wellendynamik im Bereich der Musik weiter vordringen. siehe auch Kymatik. und gruß --80.108.60.158 06:02, 14. Feb. 2014 (CET)
.. und es tanzen Ruß- und Blütenpollenbälle auf der Snare - mechanisch durch die Schallwellen in Form gehalten .. (oder es können mit Schallkanonen Kerzen auf 10 m ausgeblsen werden) .. ok. Danke. Das geht in die Richtung. Derlei suche ich vertiefend für Wellen / Felder selbst (!?), die bei Verwirbelung sich kugelförmig (walzen-/spindel-/ellipsoid/usw-förmig) ablösen. --217.84.115.89 19:09, 15. Feb. 2014 (CET)
Ein Ausgangspunkt zum „Weiterforschen“ aus mathematischer Sicht könnte die Burgersgleichung (besser en:Burgers' equation) sein, das einfachste Modell für solche, in sag mal, nichtlinearen Wellenphänomene. Insbesondere werden dadurch Schockwellen modelliert. Sie ist außerdem ein Prototyp für die numerischen und analytischen Schwierigkeiten, die bei solchen Modellen auftreten. Tropfen hingegen, das hat oben schon mal jemand anderes festgehalten, sind eher auf die Oberflächenspannung zurückzuführen und haben eigentlich nichts mit Wellen zu tun. -- HilberTraum (Diskussion) 09:49, 14. Feb. 2014 (CET)
Wellenpakete (?) mit in sich geschlossenen Feldlinien (?) °tropfen° °tropfenartig° vom sie erzeugenden schwingenden Dipol ab. (Hier [[50]] und hier [[51]]) und hier [[52]] [Kann man dieses externe Bild hier irgendwie einbinden / zeigen?]. Ganz ohne Oberflächenspannung !? Der (Wasser-)°Tropfen° als makroskopisches mechanisches Beispiel sei nur eine Analogie (!). So, wie andere Wellenphänomene, wie Solitonen & Walzen, Strudel, Turbulenzen, Spinwellen (?), Interferenzen, Überlagerungen, Polarisationen, Richtungen transversal und longitudinal, in den verschiedenen Wellenarten (em, qm, qt, qft, art(!) ) bei verschiedenen Aggregatzuständen ihre vielfältigen (!) Analogien finden .. nur keine °Tropfen° (was mich eben sehr wundert und diesen °Mangel° der Komplexität der physikalischen Beschreibung und Berechnung des Phänomens zuschreibe - mit Vielzahlen von Anfangszuständen, Randbedingungen, beteiligten Kräften und Feldern, Variablen überhaupt) .. ich würd´ ja gern deutliche Beispiele anführen, um es (was genau, weiß ich eben auch leider nicht?!) zu bekräftigen .. genau darauf zielt ja meine Frage und Bitte um Beispiele .. --217.84.115.89 18:34, 15. Feb. 2014 (CET) Noch ein [Dipol, 3d-animiert] .. (Die Impulse zerfließen in dieser Visualisierung ins Feld). Und hier: Beugung einer ebenen Welle (Phi_Index_i=45°) an der Halbebene/E-Polarisation, in sich geschlossene Feldlinien unten rechts lösen sich ab - zwar nicht das Feld selbst, wohl nur ein abklingender Wellenberg (?), (dem Zusammenhang aus Seite:[53] entnommen). --84.137.122.237 17:23, 16. Feb. 2014 (CET)
.. und noch: Feldlinien folgen dem kürzesten Weg und stoßen sich (sei es quasi oder tatsächlich oder rechnerisch) gegenseitig ab, halten also gewissermaßen analog einer Oberflächenspannung oder, wie ein Seil zusammen .. durchaus nicht diffus. Es gibt auch Modelle, die sinngem.: Zusammenhalt zwischen kleinsten Teilchen bei kurzer Kraftreichweite nur bis zu Nachbarteilchen beschreiben, o.s.ä. Da findet sich möglw. sogar eine direkte Umrechnung zwischen Oberflächenspannung und der o.g. Eigenschaft von Feldlinien. --84.137.122.237 17:23, 16. Feb. 2014 (CET)
zu über das °betrachtete System° hinausgehen hätt ich nochwas: gux du bitte da --Asteroidenbergbauer (Diskussion) 09:51, 14. Feb. 2014 (CET)
Übersetze: "Verzerrungen ["dragging" - Verschiebungen(?)] von Inertialsystemen treten in Einstein´s ART bei rotierenden Masseverteilungen als Folge eines schwachen Gravitationsfeldes langsam rotierender Massen auf. Exakte Lösungen der Einsteinschen Feldgleichungen weisen hin auf geschlossene zeitartige Linien für rotierende Kerr-swLöcher, für van Stockum Staubzylinder, für Gödel´s rotierendes Universum. Kürzlich löste der Autor [R.L.Mallett] die linearisierten Einsteinschen Feldgleichungen, um das Gravitationsfeld eines einwegigen ["unidirectional"] Ringlasers zu erhalten, bei dem ein massives rotierendes neutrales Teilchen in dessen Zentrum Inertialsystem-Verzerrung [Verschiebung(?)] aufweist.
Es wird Licht in einem photonischen Kristall ["photonic crystal"] in sehr enge spiralig-zylindrische ["helical path", "solenoid"] Bahnen gezwungen, - das Gravitationsfeld [wovon?] durch den kreisenden Lichtstrahl verstärkend." (Eckige Kommentare von mir) In den folgenden Berechnungen werden Lösungen der Feldgleichungen für das innere und aüßere Graviationsfeld mit geschlossene zeitartigen Linien bei unendlich spiralig-zylinderndem Licht, wie bei dieser Apparatur gefunden. Eine Art °Gravitations-Licht-Spule°, wohl. Eine bemerkenswerte Anordnung - bringe es nur nicht recht auf verwirbelnde Wellenfelder bezogen .. Aber "geschlossene zeitartige Linien" gehen durchaus über das betrachtete System hinaus irgendwie immerhin, °freu?° :o| --217.84.115.89 19:49, 15. Feb. 2014 (CET) Schonn "zeitartig abgelöste Feldlinien", doch ja. Danke. --84.137.122.237 17:23, 16. Feb. 2014 (CET)
<sorry quetsch again> was evtl. auch interessant in dem zusammenhang sein könnte sind die da bzw. Exact solutions in general relativity. (nicht signierter Beitrag von Asteroidenbergbauer (Diskussion | Beiträge) 09:41, 20. Feb. 2014 (CET))
Hinweis für alle später zugeschalteten Mitdiskutanten: Diese Anfrage bezieht sich auf die beiden Auskunftsanfragen Wikipedia:Auskunft/Archiv/2014/Woche 04#Feldgleichungen - Singularität - Raumzeit(en) tropfenartig abgelöst? und Wikipedia:Auskunft/Archiv/2014/Woche 05#Wellengleichung für Tropfen?. --Rôtkæppchen68 23:22, 14. Feb. 2014 (CET)

Ich mal´ Euch `mal auf, was ich meine ..

tabell. Übers.

[[54]]  Wellenart/

Phänomen    [[55]]
makro-mech. elektr. magn. em quantmech. q-feld-theor. /
Higgs-Feld
q-el.dyn. QED /
schwache We-Wirkg.
q-chromodyn./
starke We.wirkg.
grav. math./ geom./
topolog./ (Analogon/Modell/Veranschaulichg.)
Wellen ja ja ja ja ja ja ja ja ja Kurven; Funktionen
Feldlinien ja ja ja ja ja ja ja ja ja Orthogonaltrajektorie (Mathematik) --Rôtkæppchen68 12:51, 16. Feb. 2014 (CET)
Stehende Wellen ja
(Wasser-) Seiche; uvm.
 ?  ? Hohlleiter;
Opt.Reson.
Gebundene Teilchen.
H-Probl.?, Orb.?
 ?  ?  ?  ?  ?
Soliton Morning Glory Cloud;
Wasserwalze;
Tsunami;
Skyrmion?
 ? Magnon in Glasfasern;
Frequenzkamm
ja  ?  ?  ?  ? Skyrmion (stabile
Wirbel in Feldern)
Interferenz/
Superpos./
Schwebung
ja ja ja ja ja ja ja ja ja ja
Polarisation/
Ausrichtung
Seilwellen --Rôtkæppchen68 12:51, 16. Feb. 2014 (CET)  ?  ? ja ja
(Spin)
nein
(Spin 0)
(=skalare longitudinale Materiewellen?)
ja
(Spin)
ja
(Spin)
 ?  ?
uvm.
Brechung_
Beugung_
Stoßwelle
Kugelwelle
ja ja ja ja ja ja ja ja ja  ?
Strudel/Turbul./
(Ver-)Wirbel(ung)
ja ja ja ja  ?  ?  ?  ? JA Spiral-Funktionen;
redund. Funktionen (Mandelbrodt, Julia, usw.); Skyrmion?
überschlagende Wellen mit Überhang JA  ?!  ?!  ?!  ?!  ?!  ?!  ?!  ?!  ?
tropfenförmig
ablösend
JA  ?!  ?!  ?!  ?!  ?!  ?!  ?!  ?!  ?

Bitte vervollständigen & ggf korrigieren / ergänzen ! (besonders die Tropfen) Es fällt doch ins Auge, daß alle nichtmechanischen Wellen sich nicht überschlagen °dürfen°, während sie reichlich Analogien bei anderen Phänomenen zeigen und es von 1d- & 2d-Phänomenen über stationäre, homogene Zustände über bewegte Phänomene und Interaktionen bis hin zu "Verwirbelungen" °schaffen°, dann bei der naheliegenden Folge, sich auch zu überschlagen scheitern. Das ist doch einer veralteten Scheu vor Berechnung hochkomplexer Systeme geschuldet, oder nicht? .. Um diese These zu untermauern fehlen nur einige stichhaltige Beispiele sich überschlagender nichtmechanischer Wellen-Phänomene .. --217.84.115.89 22:24, 15. Feb. 2014 (CET)

Ein erster wichtiger Grund für den Unterschied ist schon mal, dass die Navier-Stokes-Gleichungen für Flüssigkeiten und Gase nichtlineare Gleichungen sind, während die Maxwell-Gleichungen zur Beschreibung elektromagnetischer Phänomene linear sind (zumindest bei als konstant angenommenen Materialkonstanten). -- HilberTraum (Diskussion) 20:16, 16. Feb. 2014 (CET)

Skyrmion-Entstehung, schem. Abb. [56] & Feldlinien-Strudel schem. Abb. [57] von Seite: [58]. ---- Kreisende magnetische Feldlinien ["vortices"] ? [59] von Seite: [60] (jedenfalls der Spin-Strömungswirbel eines spin-polarisierten Elektrons im inhomogen magnetisierten nano-ferromagnet).---- Skyrmion-Kopplung, direkt beobachtet (Fresnel) [61] von Seite: [62]. ---- Zu Tab.Zelle: Stehende Welle + qm: Spin-Bahn-Kopplung#Gebundene_Teilchen. --RoNeunzig (Diskussion) 01:39, 18. Feb. 2014 (CET)

An den UP: Ich glaube, dass Du das Pferd von hinten aufzäumst. Du schreibst: "Es fällt doch ins Auge, daß alle nichtmechanischen Wellen sich nicht überschlagen °dürfen°, während sie reichlich Analogien bei anderen Phänomenen zeigen und es von 1d- & 2d-Phänomenen über stationäre, homogene Zustände über bewegte Phänomene und Interaktionen bis hin zu "Verwirbelungen" °schaffen°, dann bei der naheliegenden Folge, sich auch zu überschlagen scheitern." Vielmehr ist es umgekehrt: Wasserwellen zeigen viele Eigenschaften von physikalischen Tranversalwellen. Sie haben aber noch viele darüber hinausgehende Eigenschaften. Der Grund ist meiner Meinung nach ein ganz einfacher: Die Wellenfunktion ist nicht irgendeine gedachte Linie sondern die Grenzfläche einer Flüssigkeit. Mit so einer Flüssigkeit kann man alles mögliche anstellen. Mit einer mathematischen Funktion aber nicht. --Pyrrhocorax (Diskussion) 22:24, 18. Feb. 2014 (CET)

Ablösung von Wirbeln!?
Aber zB Spin 1 = drei Freiheitsgrade, zwei transversale, ein longitudinaler? & Spin 0 = skalare longitudinale Materiewellen? .. Also nicht durchaus auch nichtlineare (?), komplexe (?), Eigenschaften auch bei Vakuumwellen? --217.84.120.79 17:43, 20. Feb. 2014 (CET)

Bildchen rechts. --217.84.95.167 22:56, 18. Feb. 2014 (CET) Ist das Modell der Materiewellen als Teil der Quantenmechanik eine Wellenart, die diverse Wellenphänomene zeigt (Interferenz, Streuung, Brechung); oder sind sie ein Wellenphänomen, das sich in verschiedenen Wellentheorien (Photonen - EM; Atome - QM; Elektronen - QM & QFT (?); QED (?); QCD (?); Grav.-Th. (?); makroskopisch!? - bei "Buckyballs", Molekülen ) zeigt ? --RoNeunzig (Diskussion) 20:31, 20. Feb. 2014 (CET) Hier wird von Alexander G. Kyriakos eine nichtlineare Theorie der Elementarteilchen vorgestellt ["NEPT -Nonlinear Elementary Particle Theory"] [63] "In order not to violate the principle of superposition, for a long time physicists considered that all fundamental theories must be linear. Specifically, quantum field theory was built on this basis. However, strictly speaking, in nature all processes are nonlinear." [" .. Alle Prozesse in der Natur sind (nunmal) nichtlinear"] und "It also seems that all difficulties of the existing theory of elementary particles are related to nonlinearity, since we are attempting to describe our nonlinear world using a linear model." ["Alle Probleme geltender Theorie scheinen mit Nichtlinearität zusammenzuhängen, während wir unsere nichtlineare Welt per linearem Modell zu beschreiben suchen."]. Dann "Heisenberg proposed a nonlinear equation with out the mass, which in its simplest version has the following form.   [i ˆα ∂ − λ (ψ + ˆγ ψ) ] ψ = 0 , (5.1.2)   where λ is a constant≠ and γ is the gamma set of the Dirac matrices. [Anm. Die Dächer gehören jew. auf das alpha und gamma] Equation (5.1.2) has a high degree of symmetry. However, divergences appear in the solutions of this equation≠ which are impossible to liquidate by the usual method of renormalization. Other serious difficulties also emerged, making it impossible to guarantee the symmetries of various types of particles." In der Folge mischt er von Mie über Dirac, Heisenberg und Lagrange das Standardmodell, QM, QED, QFT, und QCD offenbar auf höchstem Niveau ordentlich durch. Allerdings kommt er in 2009 noch ohne Higgs-Mechanismus aus. Nur Mie, Heisenberg, Dirac, Lagrange, Maxwell, Lorentz et al. hatten für ihre nichtlinearen Ansätze noch keine mächtigen Supercomputer für hilfreiche Simulationen komplexer Modelle!? --- Wenn es nichtlineare Phänomene bei nicht mediengebundenen Wellen gibt, fällt wohl auch die Oberflächenspannung als Argument weg (?). "nonlinear wave OR particle OR field theory" findet noch so einiges. --RoNeunzig (Diskussion) 22:55, 20. Feb. 2014 (CET) " .. so einiges." .. an nichtlinearen Ansätzen, nur keine konkreten Phänomene , die sich als Analogon in obige Tabelle eintragen ließen. --RoNeunzig (Diskussion) 16:57, 21. Feb. 2014 (CET)

Archivierung dieses Abschnittes wurde gewünscht von: --Mauerquadrant (Diskussion) 23:45, 23. Feb. 2014 (CET)